SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000025104 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000025104
Domain Number 1 Region: 50-529
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.75e-131
Family Pyridoxal-dependent decarboxylase 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000025104   Gene: ENSDNOG00000033242   Transcript: ENSDNOT00000050189
Sequence length 531
Comment pep:novel scaffold:Dasnov3.0:JH562654.1:402359:447916:1 gene:ENSDNOG00000033242 transcript:ENSDNOT00000050189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKQMSKTSIHNFQSPEKDMKTDSHTENLMTNLANAYASDLLPSKNGEDLTNRFLLHVVDI
LLHYIKKSFDVKSKILDFHHPHQLLEGLDGFNLELSDHPESLEQLLVDCTDTLKYGVKTG
HPRFFNQLSSGLDVIGLAGEWLTATANANMFTYEIAPVFTIMETILLKKMHEIIGWGETE
ADGIFSPGGSISNLYGILVARYKQYPEIKTKGMTALPCIVLFVSEQGHYSVKKAAAILGI
GTGNVIEVKCDERGKMIPAELEKNILQAKRKGQTPFCVSATAGTTVYGAFDPLLDIADIC
EKYKLWMHVDAAWGGGLLLSRSHSYKLRGIERANSVTWNPHKLMGVPLQCSAILIREKGL
LEACNQMQAGYLFQPDKLYNVDFDTGDKTIQCGRHVDIFKLWLMWKAKGTFGFEAQINRY
MELAKYFYKVLKKKDNFKLVFDAEPEFTNVCFWYFPPRLKHIPKGFERDQQLHRIAPKIK
ALMLEEGTAMISYQPCGDKVNFFRMVFSNPATKQTDVDYLLHEIERLGKGL
Download sequence
Identical sequences ENSDNOP00000025104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]