SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000025229 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000025229
Domain Number 1 Region: 685-805
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.05e-30
Family Vertebrate phospholipase A2 0.00052
Further Details:      
 
Domain Number 2 Region: 427-508
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 2.41e-18
Family Vertebrate phospholipase A2 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000025229   Gene: ENSDNOG00000048714   Transcript: ENSDNOT00000044887
Sequence length 859
Comment pep:novel scaffold:Dasnov3.0:JH569282.1:1037544:1109326:-1 gene:ENSDNOG00000048714 transcript:ENSDNOT00000044887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGFLLRGPPARLCMVLLCLQSLGNTEEAKKANGMTFLPAAESGNIEVKKEKDRDFLAAT
ELPAKSVDLSTLNLTELVNGMLGRALKDRKKFFSLLSITSYSLFAFHKFSVAIYNRVSSL
KSVDPATFPTRYCYCLNNRTNDLSDFTALLVDVIGNSTSYLTEIFKSTSILSATRGIAVS
SKPMTTSQQRPPRTSHSRWPPSLGASALRTSPWIQTTTSSEGEEPTSSARLPEPPPWATA
TGRSVSHTLPTLECAATRRAAGAPWVTASRRAQAATSPLSWAPPVSEKEPGGPPWGSPSL
TLTPPEAEKATNTRNLPGPPTRTAAPRGSPGQPGPTSGACTPGTQTLRPTKAPAPKYPQT
GDLPHLWPFTPWKEPALVPGLHQVSTVSDITFFNGVFTNVESVAEIFDCLGPRFTWLQAV
FSNFPVLLQFANGMKCVAGLCPRDFEDYGCACRFEMEGLPVDESDSCCFQHRRCYEEAAE
MDCLQDATKLPMEVDCIGKRVTCDTWSVPEQRIPSPGAGVSFPELVLQCIVKRKTMWVWS
FLSTPCLGRRRDRESQDKAQLFPGSLSPAFPGRSSSSALTALLIATGASLSPAGPEKSTD
TSLRALSGEEPDQDREDGEAAGATPPPGSVEMAATAKGVTIVPTGAKSLGLDVASLEGGP
EKTPGPACDRFTFLHQGSGDTLQVMPQLGQMLFCLTSRCPEEFESYGCYCGQEGRGDPRD
ALDRCCLSHHCCLEEVRRLGCLLERLPRSLVVCADHRPKCMGKSLCEKLLCACDQTAAEC
MASASFNQSLKSPGRRECQGSQTPCEDGRHGELSASSLGSSSEENSKEGMPATEDLGRAR
RFLGKSLGPERTRPLHGGR
Download sequence
Identical sequences ENSDNOP00000025229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]