SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000025432 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000025432
Domain Number 1 Region: 82-153
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.19e-22
Family Skp1 dimerisation domain-like 0.0000434
Further Details:      
 
Domain Number 2 Region: 10-104
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000863
Family BTB/POZ domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000025432   Gene: ENSDNOG00000039244   Transcript: ENSDNOT00000038737
Sequence length 156
Comment pep:novel scaffold:Dasnov3.0:JH575683.1:1176306:1176796:-1 gene:ENSDNOG00000039244 transcript:ENSDNOT00000038737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSMRPNMVPSVKLQNSGGERFEVDMEIVKHSETMKTMLEDLGIEEEGDDDPVPLPNINAA
ISKKVIQVTCLEDEPPPLMMMDQEFLEIDLGTLVELIPAANYLDIKGLLDGTCPSLANMT
VGKTPVEIRETVNIRNDFTEKEESQVHKENQWCEEK
Download sequence
Identical sequences ENSDNOP00000025432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]