SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000027224 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000027224
Domain Number 1 Region: 909-1040,1103-1169
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.4e-39
Family Hemopexin-like domain 0.00086
Further Details:      
 
Domain Number 2 Region: 67-107
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000017
Family Somatomedin B domain 0.0013
Further Details:      
 
Domain Number 3 Region: 26-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000119
Family Somatomedin B domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000027224   Gene: ENSDNOG00000036393   Transcript: ENSDNOT00000051782
Sequence length 1169
Comment pep:known_by_projection scaffold:Dasnov3.0:JH570015.1:1754100:1769112:1 gene:ENSDNOG00000036393 transcript:ENSDNOT00000051782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWKILPIYLLLLSVFLIQQVSSQDLSSCAGRCGQGYSRDAACNCDYNCQHYMECCPDFK
KVCTEELSCKGRCFESFVRGRECDCDAECKTYGKCCPDYADFCEEVHNPTSPPSPKTAPP
APRAPQTIKSTTKRSPKSPSKKKTKKVVESEEITEEHSISENQESSSSSSSSSRIRKVKS
SKNSAANRELQKKLKAKDKKKGTPKKRPTPEPPIVDEDGSGPDNGDFKLTPTPDIPTTQS
KKVTTSPKITTVKPKNPKPSLLPNPGMVTPKETASTVETKDTSTTDKQTSATTKEKTTSA
KETQSTEKKPAKDFVPTSEVPAKPTPKAETTKAPLLTTPKQLTPTTAKAPAPTTPEEPAP
STAKPLAPSTAQPLAPSTAKPLAPSTAKPLAPSTAKPLAPSTTKVSISTTPEEPTPTTSE
APAPSTAKAPISTTPEAPAPGTTKAPTPTTPEAPAPSTVKASIPTTSEVPTPSTTKAPTP
TSLEVPIPTTTKVPIPTPPKEPAPTTAKPLAPTTPKETAPTTAKPLAPTTPKETAPTTAK
TLAPTTPKAPAPTTAKPLAPTTPKAPAPSTAEEPSPTTPKEPAPATTRLPVPTTTVKVPS
PATPEEPLPMIPEAPAPTTYEAFIPNITVEPLTTPKTPAEPAPEFPEEPTPKALEKDPKE
PALSTVKTPDMTKPEITTTAKDKTKEKGIYTTSEITTIVPKTTTKETETTTEKTTESKIT
SSTTKVTSTTTEDTTMPSKTTPKAITITPKVSTTKTTTKTKETMNKPEKITAKPKDKAST
SKVRTPKPQKPTKAPQKPTSTKKPTITPKVKKPKTTTPSKMVSTLPELNPPSLNEAALQT
TTSPDQMVNSEIVEVNPKNENAEAAEGEKPHIIPRPPVLIPLGIPAIDSIVIGPNQGMNT
NPMFSDETNLCNGKPVDGLTTLHNGTLVAFRGHYFWMLSPFRPPSPPRRIAEVWGIPSPI
DTVFTRCNCEGKTFFFKDSQYWRFTNDKKDAGYPKQIVKGFGGLNGKIVAALSIAKYKNR
PESVYFFKTGGKIQQYIYKQEPTRTCTARRPAINYSVYGETAQVRRRRFERASGPSHTHT
VSIQYLPVRVNYQDKDFLHNEVKVSTLWRGFPNVVTSAISLPNIRKPDGYDYYAFSKDQY
YNVDVPSRTARAITTRSGQTLSKVWYNCP
Download sequence
Identical sequences ENSDNOP00000027224 XP_004468495.1.11602 XP_004468496.1.11602 XP_012384462.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]