SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000029193 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000029193
Domain Number 1 Region: 322-567
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3e-89
Family Eukaryotic proteases 0.0000303
Further Details:      
 
Domain Number 2 Region: 232-328
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-19
Family Hepsin, N-terminal domain 0.051
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000029193
Domain Number - Region: 212-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000445
Family LDL receptor-like module 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000029193   Gene: ENSDNOG00000043113   Transcript: ENSDNOT00000049854
Sequence length 575
Comment pep:known_by_projection scaffold:Dasnov3.0:JH564881.1:556578:576047:-1 gene:ENSDNOG00000043113 transcript:ENSDNOT00000049854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTQACFHPLSPTPTPRAPGSPENGETAGKLGRAGPLDFHPLGRHSPSLTFPSPGFLLQPQ
PLAPEPLPPGSAGLTNASPATASPARAAPARASPSRSSSGRSSSGRSSSARSASTTSSPT
RVYLVRATPVGTVPVRASPSRSSPATRSSPATRASGESLGLSLPKLLQESRKRLPLIGCI
LLLIGLVVALILLFLFWRGHTGIKYKEPVESCPRDAVRCDGVVDCKLKSDELGCVRFDWD
KSLLKVYSGSSHQWLPICSDSWSDSHSEKTCQQLGFESAYRTSKVPHRGFASSFSVSEYN
STLQESLHRSQCPSQKYVSLQCSHCGLRAMTGRIVGGMLSPENKWPWQVSLHYGTTHICG
GTLIDAQWVLTAAHCFFVTQEKILEGWKVYAGTNNLHQLPEAASISQIIINGNYTDEQDD
YDIALMRLSKPLTLSAHIHPVCLPMHGQTFSLNETCWITGFGKTKETDEKTSPFLREVQV
RLIDFKKCNDYLVYDSYLTPRMMCAGDLQGGRDSCQGDSGGPLVCEQNGHWYLTGVTSWG
TGCGQRNKPGVYTKVTEVLPWIYSKMESEVRFRKS
Download sequence
Identical sequences ENSDNOP00000029193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]