SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000030608 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000030608
Domain Number 1 Region: 165-308
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.36e-30
Family Eukaryotic proteases 0.00081
Further Details:      
 
Domain Number 2 Region: 73-167
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000105
Family Hepsin, N-terminal domain 0.038
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000030608
Domain Number - Region: 28-57
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00785
Family LDL receptor-like module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000030608   Gene: ENSDNOG00000045393   Transcript: ENSDNOT00000036995
Sequence length 309
Comment pep:known_by_projection scaffold:Dasnov3.0:JH564881.1:736915:751096:1 gene:ENSDNOG00000045393 transcript:ENSDNOT00000036995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQRVGVPIIAAVLSPATVTAVAVLTKAIQDKDPFLCGQSQHFIPRGLCDGRRDCAGEDKQ
HRLKNFPDELGGRVHLSKDRATLQVLDPATGAWASACFDNFTEALAKTACRQTGYDREQQ
THLQAVEIGPDQELHVAKITEHIQELQGHNSPRRCLSGSLAPLRCLGNCKKSPKAPRVVG
KEKASMDSWPWQVSGQYDRQLVCGGSILDPHCILTAAPCFRKHLHVSNWKVRAGTKLDNF
PSLPVAKIFVIGLNTKYPKEKDIFLVKPQFPRTFSDTVSPTCLPFPDEALTPSIPLWASG
WGLIEQGGG
Download sequence
Identical sequences ENSDNOP00000030608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]