SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000033329 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000033329
Domain Number 1 Region: 23-79
Classification Level Classification E-value
Superfamily L27 domain 2.83e-22
Family L27 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 96-164
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-20
Family PDZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000033329   Gene: ENSDNOG00000024299   Transcript: ENSDNOT00000037296
Sequence length 164
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568687.1:899039:1018067:1 gene:ENSDNOG00000024299 transcript:ENSDNOT00000037296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKPRVTPAPAADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSE
FCTAIREVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGF
NVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVE
Download sequence
Identical sequences ENSDNOP00000033329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]