SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000001633 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDNOP00000001633
Domain Number - Region: 19-115
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0107
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 
Domain Number - Region: 99-264
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 0.0246
Family At5g01750-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000001633   Gene: ENSDNOG00000002106   Transcript: ENSDNOT00000002105
Sequence length 275
Comment pep:novel scaffold:dasNov2:scaffold_7455:2428:11239:-1 gene:ENSDNOG00000002106 transcript:ENSDNOT00000002105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPGTAVLPSAGYPGVLPVGYYSPHQPSTFPLHQPASGVRPVQYQPGKYPMPNQPAPTMWM
PGPAPMPNCPPGLECLTQLDNIHVLQHFEPLEMFTGFETNNRYDVKNNSNQMVYVVNEDT
DDFTRNAYKTLRPFVLRVTDCLGREVITMQRPFRCTCCCFCCPSARQELEVQCPPGVTIG
FVAEHWNLCRAIYSIQNEKKENVLSVRGPCLTYGCGSDSVFEVTSLDGVTGVGSIVRKWN
GLLSAMADADHFDIHFPLDLDVKMKAMIFGACFLI
Download sequence
Identical sequences ENSDNOP00000001633 9361.ENSDNOP00000001633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]