SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000001637 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000001637
Domain Number 1 Region: 233-460
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 5.23e-74
Family Transcriptional factor tubby, C-terminal domain 0.00000000617
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000001637   Gene: ENSDNOG00000002110   Transcript: ENSDNOT00000002109
Sequence length 461
Comment pep:novel genescaffold:dasNov2:GeneScaffold_5323:67770:122727:1 gene:ENSDNOG00000002110 transcript:ENSDNOT00000002109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLDDEGSNLRQQKLDRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXQEPDSLTSVQLGAAHPTAPASAKRTKAAAAAGGQGGASRKEKRGKHKG
TGGPAALAEDKAEARGPVQILTVGQSDHAQDAGEPAAGGGARPSGQDLRAAMQRKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAASANSPKAPEPPADVEVQDLEE
FALRPAPQGVTIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYL
ISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGTLRQELAAVCYX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEHETLLARWQNKNSESIIELQNKTPVWN
DDTQSYVLNFHGRVTQASVKNFQIIHGNDPCYIVMQFGRVA
Download sequence
Identical sequences ENSDNOP00000001637 9361.ENSDNOP00000001637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]