SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000005375 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000005375
Domain Number 1 Region: 282-403
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 2.88e-41
Family Transcriptional factor tubby, C-terminal domain 0.00000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000005375   Gene: ENSDNOG00000006939   Transcript: ENSDNOT00000006937
Sequence length 403
Comment pep:novel genescaffold:dasNov2:GeneScaffold_1424:6:5673:-1 gene:ENSDNOG00000006939 transcript:ENSDNOT00000006937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGNPVFQEQVLEPHKCLAAHRTLSTVSGGDVSGEPGPLALPTEAVLRNPGLPSPSLSCLP
DSSDPELEEVSVEDVPTSPPPYKEPPGTRRRGWPARQRPGANTEDEMESQDGGDEFAEPS
LGPRPGMDSDQEQGDVASDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNVLGTKFTIFDNGVNPD
RKNFVLESARIREELGAVCYETNVLGFRGPRKMTVIIPGIDAQNQRISVQPQNEQETLLS
RLQRGANQGLVLLQNKAPSWSDESGAYVLNFHGRVTRASVKNF
Download sequence
Identical sequences 9361.ENSDNOP00000005375 ENSDNOP00000005375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]