SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000015975 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDNOP00000015975
Domain Number - Region: 274-344
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 0.0968
Family At5g01750-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000015975   Gene: ENSDNOG00000009541   Transcript: ENSDNOT00000024275
Sequence length 358
Comment pep:novel scaffold:dasNov2:scaffold_24219:11523:15838:-1 gene:ENSDNOG00000009541 transcript:ENSDNOT00000024275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APGSRGAPGTRAVLGASARGAAHEPLGWRRAQLLLRLCLCVCVCLAVPERTKQPGRRPPA
DPRPFPMAGYVPPKGYAPAAPPPYPVTTGYPEPALHPGPGQAPVPAQVPAPAPGFALFPS
PGPGAAGAAAPFLPLPGVPSGLEFLVQIDQILIHQKVERVEAFLGWESCNRYELRSGAGQ
PLGRAAEESNVCARLCCGARRPLRIRLADPWNREVLHLLRPLHCGCSCCPCGLQEXXVQP
PGTIIGHVLQWHPCLPKFSIQDADRQTVLRVVPFWTCGCGTDTNFEVKTRDESRSVGRIS
KQWGGLLQEALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGVGPSALTS
Download sequence
Identical sequences ENSDNOP00000015975 9361.ENSDNOP00000015975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]