SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000016748 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000016748
Domain Number 1 Region: 480-566
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 0.0000000000000889
Family Transcriptional factor tubby, C-terminal domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000016748
Domain Number - Region: 4-41,97-138,173-226
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000321
Family WD40-repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000016748   Gene: ENSDNOG00000025713   Transcript: ENSDNOT00000024461
Sequence length 799
Comment pep:novel genescaffold:dasNov2:GeneScaffold_2818:63437:121249:1 gene:ENSDNOG00000025713 transcript:ENSDNOT00000024461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVLVRWNEPYQKLATCDADGGIFVWIQYEGRWSVELVNDRGAQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLFGTADGQVIVMDCHGRMLAHV
LLHESDGILGMSWNYPGFLVEDSSESDTDSDDYSPPQDGPAAYPVPVQTVKPLLTVSFTS
GDISLMSSYDDLSPTVIHSGLKEVVAQWCTQGDLLAVAGMERQSQLGELPSGPLLRSALV
KFYNARGEHIFTLDTPVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARKSPKLTRAAQEASR
SPRLPVRKPSAGSPSLARRELPLDDVAQHNYLAQVTSNIWGTKFKIVGLAAFLPTNLGAV
IYKTSLLHLQPRQMTIYLPEVRKISMDYIKXXXXXXXXXXXXXXXXXXTGTSGVPESSPP
CTVNIPIAPIHSSAQAMSPTQSLGLVQSLLAAQNVQLDVLAGPGPGAELAAVPARYPSPG
QVIFGGVEVGRALPPPQLPPPPPPLGPLALPPADHGDREHEPLHRARTLRPAPQLAAEGD
AVVFSAPLEGPASKMNPPPPYPGTIPAAPTTAAPPPPLPPPXXXXXXXXXXXXXXXXXXX
XSAVQAFAVALANVTQRLK
Download sequence
Identical sequences 9361.ENSDNOP00000016748 ENSDNOP00000016748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]