SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385856587|ref|YP_005903099.1| from Neisseria meningitidis NZ-05/33

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385856587|ref|YP_005903099.1|
Domain Number 1 Region: 2-424
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.65e-128
Family GABA-aminotransferase-like 0.00000000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385856587|ref|YP_005903099.1|
Sequence length 427
Comment glutamate-1-semialdehyde-2,1-aminomutase [Neisseria meningitidis NZ-05/33]
Sequence
MNRNEILFDRAKAIIPGGVNSPVRAFGSVGGVPRFIKKAEGAYVWDENGTRYTDYVGSWG
PAIVGHAHPEVVEAVREAALGGLSFGAPTEGEIAIAEQIAKIMPSVERLRLVSSGTEATM
TAIRLARGFTGRDKIIKFEGCYHGHSDSLLVKAGSGLLTFGNPSSAGVPADFTKHTLVLE
YNNIAQLEEAFAQSGNDIACVILEPFVGNMNLVRPTEAFVKALRELTEKHGAVLIYDEVM
TGFRVALGGAQSLHGIMPDLTTMGKVIGGGMPLAAFGGRKDIMECISPLGGVYQAGTLSG
NPIAVAAGLKTLEIIRREGFYENLTARTEQLVQGFQTAADAAGIEFAADSVGGMFGLYFA
AHAPRNYADMARSNIDAFKRFFHGMLDRGIAFGPSAYEAGFVSAAHTPELIDETVAVAVE
VFKAMAA
Download sequence
Identical sequences A0A0E0TNJ0 A0A0Y5HMV9 R0TWI4
gi|385341290|ref|YP_005895161.1| gi|385856587|ref|YP_005903099.1| WP_002245202.1.100005 WP_002245202.1.100113 WP_002245202.1.10070 WP_002245202.1.102147 WP_002245202.1.11246 WP_002245202.1.11354 WP_002245202.1.11579 WP_002245202.1.11628 WP_002245202.1.1184 WP_002245202.1.12105 WP_002245202.1.12521 WP_002245202.1.12740 WP_002245202.1.12868 WP_002245202.1.13577 WP_002245202.1.13938 WP_002245202.1.14530 WP_002245202.1.14800 WP_002245202.1.15470 WP_002245202.1.16566 WP_002245202.1.17027 WP_002245202.1.17793 WP_002245202.1.17811 WP_002245202.1.19474 WP_002245202.1.19810 WP_002245202.1.20103 WP_002245202.1.2102 WP_002245202.1.21463 WP_002245202.1.22322 WP_002245202.1.22987 WP_002245202.1.22995 WP_002245202.1.23356 WP_002245202.1.23799 WP_002245202.1.24135 WP_002245202.1.25496 WP_002245202.1.25829 WP_002245202.1.25993 WP_002245202.1.26128 WP_002245202.1.26810 WP_002245202.1.27066 WP_002245202.1.27579 WP_002245202.1.27855 WP_002245202.1.27878 WP_002245202.1.28559 WP_002245202.1.29030 WP_002245202.1.29437 WP_002245202.1.29467 WP_002245202.1.3148 WP_002245202.1.32542 WP_002245202.1.3272 WP_002245202.1.34570 WP_002245202.1.38045 WP_002245202.1.38201 WP_002245202.1.38726 WP_002245202.1.40262 WP_002245202.1.40352 WP_002245202.1.40421 WP_002245202.1.42319 WP_002245202.1.43602 WP_002245202.1.457 WP_002245202.1.46715 WP_002245202.1.46830 WP_002245202.1.47544 WP_002245202.1.47594 WP_002245202.1.47656 WP_002245202.1.47876 WP_002245202.1.4928 WP_002245202.1.49556 WP_002245202.1.49679 WP_002245202.1.49698 WP_002245202.1.50702 WP_002245202.1.52250 WP_002245202.1.52487 WP_002245202.1.52552 WP_002245202.1.52694 WP_002245202.1.53078 WP_002245202.1.53311 WP_002245202.1.55133 WP_002245202.1.55187 WP_002245202.1.55433 WP_002245202.1.56375 WP_002245202.1.56859 WP_002245202.1.57363 WP_002245202.1.57485 WP_002245202.1.57856 WP_002245202.1.59153 WP_002245202.1.593 WP_002245202.1.62008 WP_002245202.1.62224 WP_002245202.1.6228 WP_002245202.1.62376 WP_002245202.1.62826 WP_002245202.1.63054 WP_002245202.1.64317 WP_002245202.1.64381 WP_002245202.1.66572 WP_002245202.1.66722 WP_002245202.1.66788 WP_002245202.1.67445 WP_002245202.1.67646 WP_002245202.1.67817 WP_002245202.1.69228 WP_002245202.1.69881 WP_002245202.1.71816 WP_002245202.1.73237 WP_002245202.1.73703 WP_002245202.1.74054 WP_002245202.1.74064 WP_002245202.1.74133 WP_002245202.1.75171 WP_002245202.1.7571 WP_002245202.1.75815 WP_002245202.1.76694 WP_002245202.1.76702 WP_002245202.1.7671 WP_002245202.1.76823 WP_002245202.1.76960 WP_002245202.1.77619 WP_002245202.1.78846 WP_002245202.1.79147 WP_002245202.1.79345 WP_002245202.1.79388 WP_002245202.1.80233 WP_002245202.1.80391 WP_002245202.1.80447 WP_002245202.1.80791 WP_002245202.1.80823 WP_002245202.1.8150 WP_002245202.1.83351 WP_002245202.1.83835 WP_002245202.1.83971 WP_002245202.1.84701 WP_002245202.1.84759 WP_002245202.1.84840 WP_002245202.1.85208 WP_002245202.1.853 WP_002245202.1.86905 WP_002245202.1.86971 WP_002245202.1.87414 WP_002245202.1.87570 WP_002245202.1.87711 WP_002245202.1.88007 WP_002245202.1.89158 WP_002245202.1.8944 WP_002245202.1.90159 WP_002245202.1.91100 WP_002245202.1.91437 WP_002245202.1.91852 WP_002245202.1.91877 WP_002245202.1.92316 WP_002245202.1.92382 WP_002245202.1.94152 WP_002245202.1.95934 WP_002245202.1.97563 WP_002245202.1.97795 WP_002245202.1.98130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]