SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385856621|ref|YP_005903133.1| from Neisseria meningitidis NZ-05/33

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385856621|ref|YP_005903133.1|
Domain Number 1 Region: 30-427
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.16e-60
Family AAT-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385856621|ref|YP_005903133.1|
Sequence length 430
Comment valine--pyruvate aminotransferase [Neisseria meningitidis NZ-05/33]
Sequence
MQFSAFGEKFTQHSGILQLMDDLGDALKSDKPVNMLGGGNPARIPEIDRAFADIFSKLAA
EHAVENIGNYSNPQGDAALIDALTAFLNREYGWNLTADNIALTNGSQNAFFYLFNLFGGK
FKLSDGTSAEKAILLPLAPEYIGYADVHIEGQHFVSAKPKIENVEHEGEAGFFKYRVNFD
ALENLPELKEGKIGAICCSRPTNPTGNVLTDGEMARLDALAQKHGIPLIIDNAYGMPFPN
IIYSDVTLNWHENIILCFSLSKVGLPGVRTGIIVAAPEVVKAVSSLNAIVNLAPTRFGAA
IAAPLLESGEMKRLADQVIRPFYRNQAQTAVSLLKRELGAYPMKIHKPEGAIFLWLWFEN
LPVSSQTLYEILKAEGTLIIPGEHFFIGIDTQDYPHAGECIRMSIAQDAQTLEKGIAAIG
KTVRKLYDNV
Download sequence
Identical sequences A0A0E0TQ00
gi|385341325|ref|YP_005895196.1| gi|385856621|ref|YP_005903133.1| WP_014580953.1.100005 WP_014580953.1.100130 WP_014580953.1.10070 WP_014580953.1.11246 WP_014580953.1.11579 WP_014580953.1.1184 WP_014580953.1.12521 WP_014580953.1.12868 WP_014580953.1.13577 WP_014580953.1.13938 WP_014580953.1.14530 WP_014580953.1.14890 WP_014580953.1.17811 WP_014580953.1.19810 WP_014580953.1.22322 WP_014580953.1.22987 WP_014580953.1.23356 WP_014580953.1.25496 WP_014580953.1.25993 WP_014580953.1.26128 WP_014580953.1.26268 WP_014580953.1.27878 WP_014580953.1.29437 WP_014580953.1.29467 WP_014580953.1.3272 WP_014580953.1.34570 WP_014580953.1.42983 WP_014580953.1.43602 WP_014580953.1.46830 WP_014580953.1.47594 WP_014580953.1.47876 WP_014580953.1.4928 WP_014580953.1.49679 WP_014580953.1.49698 WP_014580953.1.52552 WP_014580953.1.53078 WP_014580953.1.55433 WP_014580953.1.56375 WP_014580953.1.57363 WP_014580953.1.62008 WP_014580953.1.6228 WP_014580953.1.64317 WP_014580953.1.64487 WP_014580953.1.66722 WP_014580953.1.66788 WP_014580953.1.67445 WP_014580953.1.67646 WP_014580953.1.67817 WP_014580953.1.74054 WP_014580953.1.74064 WP_014580953.1.76960 WP_014580953.1.79147 WP_014580953.1.79345 WP_014580953.1.80233 WP_014580953.1.80391 WP_014580953.1.80791 WP_014580953.1.8150 WP_014580953.1.83351 WP_014580953.1.83835 WP_014580953.1.83971 WP_014580953.1.84759 WP_014580953.1.84840 WP_014580953.1.85208 WP_014580953.1.86971 WP_014580953.1.87255 WP_014580953.1.87414 WP_014580953.1.89158 WP_014580953.1.89576 WP_014580953.1.90159 WP_014580953.1.91437 WP_014580953.1.91783 WP_014580953.1.91852 WP_014580953.1.91877 WP_014580953.1.92316 WP_014580953.1.92382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]