SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385856623|ref|YP_005903135.1| from Neisseria meningitidis NZ-05/33

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385856623|ref|YP_005903135.1|
Domain Number 1 Region: 9-386
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.55e-108
Family GABA-aminotransferase-like 0.0000269
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385856623|ref|YP_005903135.1|
Sequence length 391
Comment pilin glycosylation protein PglC [Neisseria meningitidis NZ-05/33]
Sequence
MLNTSLSPWPCFTQEEADAVSKVLLSNKVNYWTGSECREFEKEFAAFAGTRYAVALSNGT
LALDAALKAIGIGEGDDVVVTSRTFLASASCIVNAGANPVFADVDLNSQNISAETVKAVL
TPNTKAIIVVHLAGMPAEMDDIMALAKEHDLWVIEDCAQAHGAKYKGKSVGSIGHVGAWS
FCQDKIMTTGGEGGMVTTNDKTLWEKMWSYKDHGKSYDAVYHREHAPGFRWLHESFGTNW
RMMEMQAVIGRIQLKRMPEWTARRRENAAKLAESLGKFKSIRLIEVAGYIEHAQYKFYAF
VKPEHLKDGWTRDRIVSELNARKVPCYQGSCSEVYLEKAFDNTPWRPKERLKNAVELGDT
SLMFLVHPTLTDGEIAFCKKHIEAVLTEAAR
Download sequence
Identical sequences A0A0E0TNS6
gi|385856623|ref|YP_005903135.1| WP_014582380.1.100130 WP_014582380.1.26268 WP_014582380.1.27855 WP_014582380.1.29467 WP_014582380.1.6228 WP_014582380.1.64487 WP_014582380.1.77619 WP_014582380.1.84759 WP_014582380.1.87255 WP_014582380.1.89576 WP_014582380.1.91783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]