SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385856694|ref|YP_005903206.1| from Neisseria meningitidis NZ-05/33

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385856694|ref|YP_005903206.1|
Domain Number 1 Region: 2-397
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.93e-114
Family AAT-like 0.000000000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385856694|ref|YP_005903206.1|
Sequence length 397
Comment aspartate transaminase [Neisseria meningitidis NZ-05/33]
Sequence
MFFKHIEAAPADPILGLGEAFKAETRPEKVNLGIGVYKDASGATPLVKAVKEAEKRLLES
ETTKNYLTIDGVADYNEQTQILLFGKDHEIIASRRAKTAQSLGGTGALRIATEFAKRQLN
AQTIWISNPTWPNHNAIAKAVGIQDKPYRYYDAAKHGLDWDGMIEDLSQAQKGDIVLLHG
CCHNPTGIDPTPEQWETLAKLSAEKGWLPLFDFAYQGFGNGLEEDAYGLRVFLKHNTELL
IASSYSKNFGMYNERVGAFTLVAEDEETAARAHSQVKTIIRTLYSNPASHGANTIALVLK
NDDLKAQWIAELDEMRGRIKAMRQKFVELLKAKGASQNFDFIIEQNGMFSFSGLTPEQVD
RLKNEFAIYAVRSGRINVAGITDDNIDYLCESIVKVL
Download sequence
Identical sequences A0A0E0TPC3 A0A0G4BYQ2 A0A0Y6CKS4
WP_002219706.1.100005 WP_002219706.1.100113 WP_002219706.1.100130 WP_002219706.1.10070 WP_002219706.1.102147 WP_002219706.1.10247 WP_002219706.1.11246 WP_002219706.1.11354 WP_002219706.1.11579 WP_002219706.1.12105 WP_002219706.1.12521 WP_002219706.1.12868 WP_002219706.1.13577 WP_002219706.1.13938 WP_002219706.1.14004 WP_002219706.1.14530 WP_002219706.1.14890 WP_002219706.1.15470 WP_002219706.1.16566 WP_002219706.1.17793 WP_002219706.1.18584 WP_002219706.1.19474 WP_002219706.1.19810 WP_002219706.1.20103 WP_002219706.1.20566 WP_002219706.1.2102 WP_002219706.1.21463 WP_002219706.1.21959 WP_002219706.1.22322 WP_002219706.1.22987 WP_002219706.1.22995 WP_002219706.1.23356 WP_002219706.1.23799 WP_002219706.1.24135 WP_002219706.1.25496 WP_002219706.1.25829 WP_002219706.1.25993 WP_002219706.1.26128 WP_002219706.1.26268 WP_002219706.1.26810 WP_002219706.1.27066 WP_002219706.1.27490 WP_002219706.1.27579 WP_002219706.1.27855 WP_002219706.1.27878 WP_002219706.1.28559 WP_002219706.1.29030 WP_002219706.1.29437 WP_002219706.1.29467 WP_002219706.1.29968 WP_002219706.1.30990 WP_002219706.1.3148 WP_002219706.1.31993 WP_002219706.1.32542 WP_002219706.1.3272 WP_002219706.1.34570 WP_002219706.1.35797 WP_002219706.1.40262 WP_002219706.1.40352 WP_002219706.1.42319 WP_002219706.1.42555 WP_002219706.1.42983 WP_002219706.1.43602 WP_002219706.1.4444 WP_002219706.1.457 WP_002219706.1.47544 WP_002219706.1.47594 WP_002219706.1.47656 WP_002219706.1.47876 WP_002219706.1.4928 WP_002219706.1.49679 WP_002219706.1.49698 WP_002219706.1.51001 WP_002219706.1.52250 WP_002219706.1.52552 WP_002219706.1.54707 WP_002219706.1.55187 WP_002219706.1.55433 WP_002219706.1.56375 WP_002219706.1.56859 WP_002219706.1.57363 WP_002219706.1.57856 WP_002219706.1.59153 WP_002219706.1.62008 WP_002219706.1.6228 WP_002219706.1.63054 WP_002219706.1.64317 WP_002219706.1.64381 WP_002219706.1.64487 WP_002219706.1.66373 WP_002219706.1.66722 WP_002219706.1.66788 WP_002219706.1.67445 WP_002219706.1.67646 WP_002219706.1.67817 WP_002219706.1.69228 WP_002219706.1.71001 WP_002219706.1.71816 WP_002219706.1.73237 WP_002219706.1.73703 WP_002219706.1.74054 WP_002219706.1.74064 WP_002219706.1.75171 WP_002219706.1.7571 WP_002219706.1.76694 WP_002219706.1.76702 WP_002219706.1.7671 WP_002219706.1.76823 WP_002219706.1.76960 WP_002219706.1.77619 WP_002219706.1.78846 WP_002219706.1.79147 WP_002219706.1.79345 WP_002219706.1.79388 WP_002219706.1.80391 WP_002219706.1.80447 WP_002219706.1.80791 WP_002219706.1.8150 WP_002219706.1.81706 WP_002219706.1.83351 WP_002219706.1.83835 WP_002219706.1.83971 WP_002219706.1.83990 WP_002219706.1.84759 WP_002219706.1.84840 WP_002219706.1.85208 WP_002219706.1.86971 WP_002219706.1.87255 WP_002219706.1.87414 WP_002219706.1.87570 WP_002219706.1.88007 WP_002219706.1.89158 WP_002219706.1.89576 WP_002219706.1.90159 WP_002219706.1.91437 WP_002219706.1.91783 WP_002219706.1.91852 WP_002219706.1.91877 WP_002219706.1.92382 WP_002219706.1.92753 WP_002219706.1.94239 WP_002219706.1.97563 WP_002219706.1.98130 gi|385856694|ref|YP_005903206.1| gi|385342465|ref|YP_005896336.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]