SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385856889|ref|YP_005903401.1| from Neisseria meningitidis NZ-05/33

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385856889|ref|YP_005903401.1|
Domain Number 1 Region: 9-431
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.14e-130
Family GABA-aminotransferase-like 0.000000000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385856889|ref|YP_005903401.1|
Sequence length 433
Comment adenosylmethionine-8-amino-7-oxononanoate transaminase [Neisseria meningitidis NZ-05/33]
Sequence
MPSEHQHTSSLLDFDRTHLLHPYTSMTDPLPVYPVKRAEGVFIELADGTRLVDGMSSWWC
AIHGYNHPVLNQAVETQIKQMSHVMFGGLTHEPAVELGKLLVGILPQGLDRIFYADSGSV
SVEVALKMAVQYRQVRGLTAKQNIATVRRGYHGDTWNAMSVCDPETGMHHIFGSALPQRY
FVDNPTSRFDDEWDEADLQPVRALFEVHHADIAAFILEPVVQGAGGMYFYHPQYLRGLRD
LCDEFDIVLIFDEIATGFGRTGKMFACEHAEVVPDIMCIGKGLSGGYMTLAAAITSQKVT
ETISRGEAGVFMHGPTFMANPLACAVACASVKLLLSQDWQANIRRIESILKGRLKAAWDI
RGVKDVRVLGAIGVIELDKGVDMARFQADCVAQGIWVRPFGRLVYLMPPYIISDGVLTKL
ADKTVQILKEHSK
Download sequence
Identical sequences A0A0E0TPW8 A0A0G4BZ92 A0A0Y6RLI9 A1KSZ4
gi|385856889|ref|YP_005903401.1| gi|121634529|ref|YP_974774.1| WP_002221232.1.100005 WP_002221232.1.100113 WP_002221232.1.100130 WP_002221232.1.10070 WP_002221232.1.101031 WP_002221232.1.101472 WP_002221232.1.101655 WP_002221232.1.102060 WP_002221232.1.102138 WP_002221232.1.102147 WP_002221232.1.10289 WP_002221232.1.10661 WP_002221232.1.10682 WP_002221232.1.11246 WP_002221232.1.11276 WP_002221232.1.11354 WP_002221232.1.11384 WP_002221232.1.11579 WP_002221232.1.11628 WP_002221232.1.11670 WP_002221232.1.1184 WP_002221232.1.12105 WP_002221232.1.12163 WP_002221232.1.12521 WP_002221232.1.12740 WP_002221232.1.12868 WP_002221232.1.13098 WP_002221232.1.13470 WP_002221232.1.13577 WP_002221232.1.13587 WP_002221232.1.13907 WP_002221232.1.13938 WP_002221232.1.14047 WP_002221232.1.14530 WP_002221232.1.14537 WP_002221232.1.14724 WP_002221232.1.14800 WP_002221232.1.14890 WP_002221232.1.15475 WP_002221232.1.16257 WP_002221232.1.16393 WP_002221232.1.16566 WP_002221232.1.17027 WP_002221232.1.17523 WP_002221232.1.17793 WP_002221232.1.18517 WP_002221232.1.18584 WP_002221232.1.19059 WP_002221232.1.19474 WP_002221232.1.19810 WP_002221232.1.19822 WP_002221232.1.19909 WP_002221232.1.20103 WP_002221232.1.2102 WP_002221232.1.21050 WP_002221232.1.21463 WP_002221232.1.22254 WP_002221232.1.22274 WP_002221232.1.22322 WP_002221232.1.22987 WP_002221232.1.22995 WP_002221232.1.23356 WP_002221232.1.24135 WP_002221232.1.24298 WP_002221232.1.24605 WP_002221232.1.24622 WP_002221232.1.25003 WP_002221232.1.25146 WP_002221232.1.25496 WP_002221232.1.25822 WP_002221232.1.25829 WP_002221232.1.2595 WP_002221232.1.25993 WP_002221232.1.26128 WP_002221232.1.26152 WP_002221232.1.26268 WP_002221232.1.26810 WP_002221232.1.27066 WP_002221232.1.27436 WP_002221232.1.27485 WP_002221232.1.27579 WP_002221232.1.27855 WP_002221232.1.27878 WP_002221232.1.28559 WP_002221232.1.28626 WP_002221232.1.2875 WP_002221232.1.29030 WP_002221232.1.29182 WP_002221232.1.29189 WP_002221232.1.29437 WP_002221232.1.29467 WP_002221232.1.29595 WP_002221232.1.29968 WP_002221232.1.30701 WP_002221232.1.30850 WP_002221232.1.3148 WP_002221232.1.31811 WP_002221232.1.31850 WP_002221232.1.31993 WP_002221232.1.32542 WP_002221232.1.32665 WP_002221232.1.3272 WP_002221232.1.32975 WP_002221232.1.33744 WP_002221232.1.34271 WP_002221232.1.34570 WP_002221232.1.34765 WP_002221232.1.35055 WP_002221232.1.35315 WP_002221232.1.35813 WP_002221232.1.35931 WP_002221232.1.36245 WP_002221232.1.36415 WP_002221232.1.36490 WP_002221232.1.36606 WP_002221232.1.37727 WP_002221232.1.38045 WP_002221232.1.38054 WP_002221232.1.38201 WP_002221232.1.38239 WP_002221232.1.38295 WP_002221232.1.38726 WP_002221232.1.38801 WP_002221232.1.39248 WP_002221232.1.40262 WP_002221232.1.40352 WP_002221232.1.40847 WP_002221232.1.40940 WP_002221232.1.40989 WP_002221232.1.41013 WP_002221232.1.42319 WP_002221232.1.425 WP_002221232.1.42555 WP_002221232.1.42656 WP_002221232.1.42983 WP_002221232.1.43602 WP_002221232.1.43987 WP_002221232.1.44572 WP_002221232.1.44580 WP_002221232.1.45642 WP_002221232.1.45671 WP_002221232.1.457 WP_002221232.1.466 WP_002221232.1.46627 WP_002221232.1.46715 WP_002221232.1.4705 WP_002221232.1.47277 WP_002221232.1.47544 WP_002221232.1.47594 WP_002221232.1.47656 WP_002221232.1.4784 WP_002221232.1.47876 WP_002221232.1.48453 WP_002221232.1.4928 WP_002221232.1.49556 WP_002221232.1.49679 WP_002221232.1.49698 WP_002221232.1.49775 WP_002221232.1.50702 WP_002221232.1.51001 WP_002221232.1.51446 WP_002221232.1.52250 WP_002221232.1.52552 WP_002221232.1.52694 WP_002221232.1.52785 WP_002221232.1.53014 WP_002221232.1.53311 WP_002221232.1.53501 WP_002221232.1.53544 WP_002221232.1.54018 WP_002221232.1.54436 WP_002221232.1.54456 WP_002221232.1.54666 WP_002221232.1.54707 WP_002221232.1.5498 WP_002221232.1.55031 WP_002221232.1.55133 WP_002221232.1.55187 WP_002221232.1.554 WP_002221232.1.55433 WP_002221232.1.55764 WP_002221232.1.56186 WP_002221232.1.56375 WP_002221232.1.56544 WP_002221232.1.56763 WP_002221232.1.57008 WP_002221232.1.5706 WP_002221232.1.57238 WP_002221232.1.57289 WP_002221232.1.57363 WP_002221232.1.57387 WP_002221232.1.57485 WP_002221232.1.57626 WP_002221232.1.57856 WP_002221232.1.58178 WP_002221232.1.58501 WP_002221232.1.58882 WP_002221232.1.59153 WP_002221232.1.59875 WP_002221232.1.60604 WP_002221232.1.6080 WP_002221232.1.6113 WP_002221232.1.6127 WP_002221232.1.62008 WP_002221232.1.62224 WP_002221232.1.6228 WP_002221232.1.62662 WP_002221232.1.62726 WP_002221232.1.62942 WP_002221232.1.63054 WP_002221232.1.63755 WP_002221232.1.64152 WP_002221232.1.64317 WP_002221232.1.64381 WP_002221232.1.64487 WP_002221232.1.64741 WP_002221232.1.65694 WP_002221232.1.65724 WP_002221232.1.65919 WP_002221232.1.65942 WP_002221232.1.66034 WP_002221232.1.66444 WP_002221232.1.66572 WP_002221232.1.66722 WP_002221232.1.66788 WP_002221232.1.67190 WP_002221232.1.67289 WP_002221232.1.6741 WP_002221232.1.67445 WP_002221232.1.6749 WP_002221232.1.67646 WP_002221232.1.67687 WP_002221232.1.67817 WP_002221232.1.67985 WP_002221232.1.68437 WP_002221232.1.69228 WP_002221232.1.70172 WP_002221232.1.70252 WP_002221232.1.70953 WP_002221232.1.71485 WP_002221232.1.71789 WP_002221232.1.71816 WP_002221232.1.72080 WP_002221232.1.72311 WP_002221232.1.72637 WP_002221232.1.72868 WP_002221232.1.73111 WP_002221232.1.73237 WP_002221232.1.73703 WP_002221232.1.73922 WP_002221232.1.74054 WP_002221232.1.74064 WP_002221232.1.74133 WP_002221232.1.74771 WP_002221232.1.75106 WP_002221232.1.75171 WP_002221232.1.75299 WP_002221232.1.75688 WP_002221232.1.7571 WP_002221232.1.75815 WP_002221232.1.75849 WP_002221232.1.76330 WP_002221232.1.76694 WP_002221232.1.76702 WP_002221232.1.7671 WP_002221232.1.7676 WP_002221232.1.76807 WP_002221232.1.76823 WP_002221232.1.76960 WP_002221232.1.77030 WP_002221232.1.77248 WP_002221232.1.77619 WP_002221232.1.77679 WP_002221232.1.78846 WP_002221232.1.78905 WP_002221232.1.79147 WP_002221232.1.79345 WP_002221232.1.79388 WP_002221232.1.7942 WP_002221232.1.79489 WP_002221232.1.79912 WP_002221232.1.80076 WP_002221232.1.80233 WP_002221232.1.80391 WP_002221232.1.80791 WP_002221232.1.80823 WP_002221232.1.81005 WP_002221232.1.8150 WP_002221232.1.81706 WP_002221232.1.83351 WP_002221232.1.83633 WP_002221232.1.83835 WP_002221232.1.83867 WP_002221232.1.83954 WP_002221232.1.83971 WP_002221232.1.83990 WP_002221232.1.84565 WP_002221232.1.84604 WP_002221232.1.84701 WP_002221232.1.84759 WP_002221232.1.84834 WP_002221232.1.84840 WP_002221232.1.8494 WP_002221232.1.84962 WP_002221232.1.85200 WP_002221232.1.85208 WP_002221232.1.853 WP_002221232.1.85974 WP_002221232.1.86132 WP_002221232.1.86394 WP_002221232.1.86971 WP_002221232.1.87255 WP_002221232.1.87414 WP_002221232.1.87513 WP_002221232.1.87570 WP_002221232.1.87711 WP_002221232.1.88007 WP_002221232.1.88223 WP_002221232.1.88349 WP_002221232.1.88546 WP_002221232.1.88755 WP_002221232.1.89158 WP_002221232.1.8944 WP_002221232.1.89456 WP_002221232.1.89576 WP_002221232.1.90159 WP_002221232.1.90294 WP_002221232.1.90460 WP_002221232.1.90492 WP_002221232.1.91100 WP_002221232.1.91395 WP_002221232.1.91437 WP_002221232.1.91783 WP_002221232.1.91852 WP_002221232.1.91877 WP_002221232.1.91980 WP_002221232.1.92382 WP_002221232.1.92756 WP_002221232.1.93756 WP_002221232.1.94047 WP_002221232.1.94152 WP_002221232.1.94239 WP_002221232.1.94259 WP_002221232.1.9571 WP_002221232.1.95768 WP_002221232.1.95799 WP_002221232.1.96262 WP_002221232.1.98130 WP_002221232.1.98951 WP_002221232.1.9906 WP_002221232.1.99100 WP_002221232.1.99537 WP_002221232.1.99570 WP_002221232.1.99597 gi|385339709|ref|YP_005893581.1| gi|385342264|ref|YP_005896135.1| 272831.NMC0685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]