SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385857040|ref|YP_005903552.1| from Neisseria meningitidis NZ-05/33

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385857040|ref|YP_005903552.1|
Domain Number 1 Region: 2-392
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.18e-80
Family AAT-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385857040|ref|YP_005903552.1|
Sequence length 395
Comment class I and II aminotransferase [Neisseria meningitidis NZ-05/33]
Sequence
MNTLLNQLKPYPFARLREAMQGISAPEGLEAVPLHIGEPKHPTPKVITDALTASLHELEK
YPLTAGLPELRQACANWLKRRYDGLTVDADNEILPVLGSREALFSFVQTVLDPVSDGIKP
AIVSPNPFYQIYEGATLLGGGEIHFANCPAPSFNPDWRSISEEVWKRTKLVFVCSPNNPS
GSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCLQAAAQLGRSRQKLLMFT
SLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAWDDEQHVIDNRR
LYQEKFERVIPILQQVFDVKLPDASFYIWLKVPDGDDLAFARNLWQKAAIQVLPGRFLAR
DTEQGNPGEGYVRIALVADVATCVKAAETIVSLYR
Download sequence
Identical sequences A0A0E0TQ08 A0A0Y5YCZ3
WP_014582409.1.100005 WP_014582409.1.100113 WP_014582409.1.100130 WP_014582409.1.102147 WP_014582409.1.11246 WP_014582409.1.11354 WP_014582409.1.11579 WP_014582409.1.11628 WP_014582409.1.1184 WP_014582409.1.12105 WP_014582409.1.12521 WP_014582409.1.12740 WP_014582409.1.12868 WP_014582409.1.13577 WP_014582409.1.13938 WP_014582409.1.14530 WP_014582409.1.14800 WP_014582409.1.14890 WP_014582409.1.15470 WP_014582409.1.16566 WP_014582409.1.17793 WP_014582409.1.17811 WP_014582409.1.19474 WP_014582409.1.20103 WP_014582409.1.2102 WP_014582409.1.21463 WP_014582409.1.22322 WP_014582409.1.22987 WP_014582409.1.22995 WP_014582409.1.23356 WP_014582409.1.24135 WP_014582409.1.25496 WP_014582409.1.25829 WP_014582409.1.25993 WP_014582409.1.26128 WP_014582409.1.26268 WP_014582409.1.26810 WP_014582409.1.27066 WP_014582409.1.27579 WP_014582409.1.27855 WP_014582409.1.27878 WP_014582409.1.28559 WP_014582409.1.29030 WP_014582409.1.29437 WP_014582409.1.29467 WP_014582409.1.3148 WP_014582409.1.32542 WP_014582409.1.3272 WP_014582409.1.34570 WP_014582409.1.38045 WP_014582409.1.38201 WP_014582409.1.40262 WP_014582409.1.40352 WP_014582409.1.42319 WP_014582409.1.42983 WP_014582409.1.457 WP_014582409.1.46715 WP_014582409.1.46830 WP_014582409.1.47544 WP_014582409.1.47594 WP_014582409.1.47656 WP_014582409.1.47876 WP_014582409.1.4928 WP_014582409.1.49556 WP_014582409.1.49698 WP_014582409.1.50702 WP_014582409.1.52250 WP_014582409.1.52487 WP_014582409.1.52552 WP_014582409.1.52694 WP_014582409.1.53078 WP_014582409.1.53311 WP_014582409.1.55187 WP_014582409.1.55433 WP_014582409.1.56375 WP_014582409.1.56859 WP_014582409.1.57363 WP_014582409.1.57485 WP_014582409.1.57856 WP_014582409.1.59153 WP_014582409.1.6228 WP_014582409.1.62376 WP_014582409.1.63054 WP_014582409.1.64317 WP_014582409.1.64381 WP_014582409.1.64487 WP_014582409.1.66572 WP_014582409.1.66722 WP_014582409.1.66788 WP_014582409.1.67445 WP_014582409.1.67646 WP_014582409.1.69228 WP_014582409.1.71816 WP_014582409.1.73237 WP_014582409.1.73703 WP_014582409.1.74054 WP_014582409.1.74064 WP_014582409.1.74133 WP_014582409.1.75171 WP_014582409.1.7571 WP_014582409.1.75815 WP_014582409.1.76694 WP_014582409.1.7671 WP_014582409.1.76823 WP_014582409.1.76960 WP_014582409.1.77619 WP_014582409.1.78846 WP_014582409.1.79147 WP_014582409.1.79345 WP_014582409.1.79388 WP_014582409.1.80233 WP_014582409.1.80391 WP_014582409.1.80447 WP_014582409.1.80823 WP_014582409.1.8150 WP_014582409.1.83351 WP_014582409.1.83835 WP_014582409.1.83971 WP_014582409.1.84701 WP_014582409.1.84759 WP_014582409.1.84840 WP_014582409.1.85208 WP_014582409.1.86971 WP_014582409.1.87255 WP_014582409.1.87414 WP_014582409.1.87570 WP_014582409.1.87711 WP_014582409.1.88007 WP_014582409.1.89158 WP_014582409.1.8944 WP_014582409.1.89576 WP_014582409.1.90159 WP_014582409.1.91100 WP_014582409.1.91437 WP_014582409.1.91783 WP_014582409.1.91877 WP_014582409.1.92316 WP_014582409.1.92382 WP_014582409.1.94152 WP_014582409.1.97563 gi|385857040|ref|YP_005903552.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]