SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385857170|ref|YP_005903682.1| from Neisseria meningitidis NZ-05/33

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385857170|ref|YP_005903682.1|
Domain Number 1 Region: 8-415
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.47e-180
Family GABA-aminotransferase-like 0.000000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385857170|ref|YP_005903682.1|
Sequence length 416
Comment serine hydroxymethyltransferase [Neisseria meningitidis NZ-05/33]
Sequence
MFSKSVTLAQYDPDLAAAIAQEDQRQQDHVELIASENYVSCAVMETQGSQLTNKYAEGYP
GKRYYGGCEYVDIVEQLAIDRVKKLFGAQYANVQPHSGSQANQAVYASVLKPGDTILGMS
LAHGGHLTHGASVNISGKLYNAVTYGLDENEVLDYAEVERLALEHKPKMIVAGASAYALQ
IDWAKFREIADKVGAYLFVDMAHYAGLIAGGEYPNPVPFCDFVTTTTHKTLRGPRGGVIL
CRDNTHEKALNSSIFPSLQGGPLMHVIAAKAVAFKEALQPEFKQYAKQVKINAAAMAEEL
VKRGLRIVSGRTESHVFLVDLQPMKITGKAAEAALGKAHITVNKNAIPNDPEKPFVTSGI
RIGSAAMTTRGFNEADARVLANLVADVLSNPEDEANLAKVREQVTALCNKYTVYGA
Download sequence
Identical sequences A0A0E0TQD8
WP_014582429.1.19810 WP_014582429.1.2102 WP_014582429.1.23356 WP_014582429.1.27855 WP_014582429.1.29437 WP_014582429.1.29467 WP_014582429.1.3272 WP_014582429.1.40262 WP_014582429.1.47544 WP_014582429.1.4928 WP_014582429.1.49679 WP_014582429.1.52250 WP_014582429.1.55187 WP_014582429.1.56375 WP_014582429.1.6228 WP_014582429.1.64317 WP_014582429.1.64381 WP_014582429.1.66572 WP_014582429.1.66722 WP_014582429.1.66788 WP_014582429.1.67445 WP_014582429.1.67817 WP_014582429.1.77619 WP_014582429.1.78846 WP_014582429.1.83835 WP_014582429.1.83971 WP_014582429.1.84759 WP_014582429.1.87711 WP_014582429.1.89158 WP_014582429.1.90159 gi|385857170|ref|YP_005903682.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]