SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385857440|ref|YP_005903952.1| from Neisseria meningitidis NZ-05/33

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385857440|ref|YP_005903952.1|
Domain Number 1 Region: 7-390
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.48e-129
Family GABA-aminotransferase-like 0.000000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385857440|ref|YP_005903952.1|
Sequence length 398
Comment acetylornithine transaminase/succinyldiaminopimelate transaminase [Neisseria meningitidis NZ-05/33]
Sequence
MQNYLTPNFAFAPMIPERASGSRVWDTEGREYIDFSGGIAVNALGHCHPALADALNAQMH
KLWHISNIYTTRPAQELAQKLVANSFADKVFFCNSGAEANEAALKLARKYARDRFGGGKS
EIVACINSFHGRTLFTVSVGGQPKYSKDYAPLPQGITHVPFNDIAALEAAVGEQTCAVII
EPIQGESGILPATAEYLQTARRLCDRHNALLILDEVQTGMGHTGRLFAYEHYGVVPDILS
SAKALGCGFPIGAMLATEKIAAAFQPGTHGSTFGGNPMACAVGSRAFDIINTPETLNHVR
EQGQKLQTALLDLCRKTGLFSQVRGMGLLLGCVLDEAYRGRASEITAAALKHGVMILVAG
ADVLRFAPSLLLNDEDMAEGLRRLEHALTEFAATSDNP
Download sequence
Identical sequences A0A0E0TR38 A0A0Y5I6M6 R0U1V7
gi|385857440|ref|YP_005903952.1| gi|385341714|ref|YP_005895585.1| WP_002238022.1.100005 WP_002238022.1.100113 WP_002238022.1.100130 WP_002238022.1.10070 WP_002238022.1.102147 WP_002238022.1.11246 WP_002238022.1.11354 WP_002238022.1.11579 WP_002238022.1.11628 WP_002238022.1.1184 WP_002238022.1.12105 WP_002238022.1.12521 WP_002238022.1.12740 WP_002238022.1.12868 WP_002238022.1.13577 WP_002238022.1.13938 WP_002238022.1.14530 WP_002238022.1.14800 WP_002238022.1.14890 WP_002238022.1.15470 WP_002238022.1.16566 WP_002238022.1.17793 WP_002238022.1.17811 WP_002238022.1.19474 WP_002238022.1.19810 WP_002238022.1.20103 WP_002238022.1.21463 WP_002238022.1.22322 WP_002238022.1.22987 WP_002238022.1.23356 WP_002238022.1.24135 WP_002238022.1.25496 WP_002238022.1.25829 WP_002238022.1.25993 WP_002238022.1.26128 WP_002238022.1.26268 WP_002238022.1.26810 WP_002238022.1.27066 WP_002238022.1.27579 WP_002238022.1.27878 WP_002238022.1.28559 WP_002238022.1.29030 WP_002238022.1.29437 WP_002238022.1.29467 WP_002238022.1.3148 WP_002238022.1.32542 WP_002238022.1.3272 WP_002238022.1.34570 WP_002238022.1.38045 WP_002238022.1.38201 WP_002238022.1.38726 WP_002238022.1.40262 WP_002238022.1.40352 WP_002238022.1.42319 WP_002238022.1.42555 WP_002238022.1.42983 WP_002238022.1.43602 WP_002238022.1.457 WP_002238022.1.46523 WP_002238022.1.46715 WP_002238022.1.46830 WP_002238022.1.47544 WP_002238022.1.47594 WP_002238022.1.47656 WP_002238022.1.47876 WP_002238022.1.4928 WP_002238022.1.49556 WP_002238022.1.49679 WP_002238022.1.49698 WP_002238022.1.50702 WP_002238022.1.52487 WP_002238022.1.52552 WP_002238022.1.52694 WP_002238022.1.53311 WP_002238022.1.55133 WP_002238022.1.55187 WP_002238022.1.55433 WP_002238022.1.56375 WP_002238022.1.56859 WP_002238022.1.57363 WP_002238022.1.57485 WP_002238022.1.57856 WP_002238022.1.59153 WP_002238022.1.62008 WP_002238022.1.62224 WP_002238022.1.6228 WP_002238022.1.62376 WP_002238022.1.63054 WP_002238022.1.64381 WP_002238022.1.64487 WP_002238022.1.66572 WP_002238022.1.66722 WP_002238022.1.66788 WP_002238022.1.67646 WP_002238022.1.67817 WP_002238022.1.69228 WP_002238022.1.69881 WP_002238022.1.71816 WP_002238022.1.73237 WP_002238022.1.73703 WP_002238022.1.74054 WP_002238022.1.74064 WP_002238022.1.74133 WP_002238022.1.75171 WP_002238022.1.7571 WP_002238022.1.75815 WP_002238022.1.76694 WP_002238022.1.76702 WP_002238022.1.7671 WP_002238022.1.76823 WP_002238022.1.76960 WP_002238022.1.78846 WP_002238022.1.79147 WP_002238022.1.79345 WP_002238022.1.79388 WP_002238022.1.80233 WP_002238022.1.80391 WP_002238022.1.80447 WP_002238022.1.80791 WP_002238022.1.80823 WP_002238022.1.8150 WP_002238022.1.83351 WP_002238022.1.83835 WP_002238022.1.83971 WP_002238022.1.84701 WP_002238022.1.84759 WP_002238022.1.84840 WP_002238022.1.85208 WP_002238022.1.853 WP_002238022.1.86971 WP_002238022.1.87255 WP_002238022.1.87414 WP_002238022.1.87570 WP_002238022.1.87711 WP_002238022.1.89158 WP_002238022.1.8944 WP_002238022.1.90159 WP_002238022.1.91100 WP_002238022.1.91437 WP_002238022.1.91852 WP_002238022.1.91877 WP_002238022.1.92316 WP_002238022.1.92382 WP_002238022.1.94152 WP_002238022.1.94239 WP_002238022.1.97563 WP_002238022.1.97795 WP_002238022.1.98130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]