SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385857447|ref|YP_005903959.1| from Neisseria meningitidis NZ-05/33

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385857447|ref|YP_005903959.1|
Domain Number 1 Region: 5-390
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.13e-110
Family Cystathionine synthase-like 0.000000000095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385857447|ref|YP_005903959.1|
Sequence length 404
Comment cysteine desulfurase IscS [Neisseria meningitidis NZ-05/33]
Sequence
MTVKTPVYLDYAATTTVDKRVAEKMIPYLTETFGNPASNSHAFGWEAEEAVEKARADIAA
LINADPKEIVFTSGATESDNLAIKGAANFYKTKGKHLITVKTEHKAVLDTMRELERQGFE
VTYLGVQENGLIDLEELKAAIRDDTILVSVMWANNEIGVVQDIPAIGEICRERKIVFHVD
AAQACGKVPVDVEAAKIDLLSMSAHKVYGPKGIGALYVRRKPRVRLEAQMHGGGHERGFR
SGTLPTHQIVGMGEAFRIAKEELAQDTAHYLKLRDIFLKGIEGIEEVYINGDLGHRAPNN
LNVSFNFVEGESLIMAVKELAVSSGSACTSASLEPSYVLRALGRNDELAHSSLRITFGRM
TTEEEVQFAAELIKSKIGKLRELSPLWEMFKDGIDLNSIEWAAH
Download sequence
Identical sequences A0A0E0TQV2 A0A112HCV3
gi|385341706|ref|YP_005895577.1| gi|385857447|ref|YP_005903959.1| WP_014581037.1.100005 WP_014581037.1.100113 WP_014581037.1.100130 WP_014581037.1.10070 WP_014581037.1.102147 WP_014581037.1.11104 WP_014581037.1.11246 WP_014581037.1.11354 WP_014581037.1.11579 WP_014581037.1.11628 WP_014581037.1.1184 WP_014581037.1.12105 WP_014581037.1.12521 WP_014581037.1.12740 WP_014581037.1.12868 WP_014581037.1.13938 WP_014581037.1.14530 WP_014581037.1.14800 WP_014581037.1.14890 WP_014581037.1.15470 WP_014581037.1.16566 WP_014581037.1.17793 WP_014581037.1.17811 WP_014581037.1.17996 WP_014581037.1.19474 WP_014581037.1.19810 WP_014581037.1.20103 WP_014581037.1.20566 WP_014581037.1.22322 WP_014581037.1.22987 WP_014581037.1.23356 WP_014581037.1.24135 WP_014581037.1.25829 WP_014581037.1.25993 WP_014581037.1.26128 WP_014581037.1.26268 WP_014581037.1.26810 WP_014581037.1.27066 WP_014581037.1.27490 WP_014581037.1.27579 WP_014581037.1.27878 WP_014581037.1.28559 WP_014581037.1.29030 WP_014581037.1.29437 WP_014581037.1.29467 WP_014581037.1.3148 WP_014581037.1.32542 WP_014581037.1.3272 WP_014581037.1.34570 WP_014581037.1.38045 WP_014581037.1.38201 WP_014581037.1.38726 WP_014581037.1.40262 WP_014581037.1.40352 WP_014581037.1.41717 WP_014581037.1.42319 WP_014581037.1.42555 WP_014581037.1.42983 WP_014581037.1.43602 WP_014581037.1.44753 WP_014581037.1.457 WP_014581037.1.46715 WP_014581037.1.46830 WP_014581037.1.47544 WP_014581037.1.47594 WP_014581037.1.47656 WP_014581037.1.47876 WP_014581037.1.4928 WP_014581037.1.49556 WP_014581037.1.49679 WP_014581037.1.49698 WP_014581037.1.51761 WP_014581037.1.52487 WP_014581037.1.52552 WP_014581037.1.52694 WP_014581037.1.53078 WP_014581037.1.53311 WP_014581037.1.55133 WP_014581037.1.55187 WP_014581037.1.55433 WP_014581037.1.56375 WP_014581037.1.56859 WP_014581037.1.57363 WP_014581037.1.57485 WP_014581037.1.57856 WP_014581037.1.59153 WP_014581037.1.62008 WP_014581037.1.62224 WP_014581037.1.6228 WP_014581037.1.62376 WP_014581037.1.63054 WP_014581037.1.64317 WP_014581037.1.64381 WP_014581037.1.64487 WP_014581037.1.66572 WP_014581037.1.66722 WP_014581037.1.66788 WP_014581037.1.67445 WP_014581037.1.67646 WP_014581037.1.67817 WP_014581037.1.68324 WP_014581037.1.69228 WP_014581037.1.71041 WP_014581037.1.71816 WP_014581037.1.73237 WP_014581037.1.74054 WP_014581037.1.74064 WP_014581037.1.74133 WP_014581037.1.75171 WP_014581037.1.7571 WP_014581037.1.75815 WP_014581037.1.76694 WP_014581037.1.76702 WP_014581037.1.7671 WP_014581037.1.76823 WP_014581037.1.76960 WP_014581037.1.78133 WP_014581037.1.78846 WP_014581037.1.79147 WP_014581037.1.79345 WP_014581037.1.79388 WP_014581037.1.80233 WP_014581037.1.80391 WP_014581037.1.80447 WP_014581037.1.80791 WP_014581037.1.80823 WP_014581037.1.8150 WP_014581037.1.83351 WP_014581037.1.83835 WP_014581037.1.83971 WP_014581037.1.84701 WP_014581037.1.84759 WP_014581037.1.84840 WP_014581037.1.85208 WP_014581037.1.853 WP_014581037.1.86971 WP_014581037.1.87255 WP_014581037.1.87414 WP_014581037.1.87570 WP_014581037.1.87711 WP_014581037.1.89158 WP_014581037.1.8944 WP_014581037.1.89576 WP_014581037.1.90159 WP_014581037.1.91100 WP_014581037.1.91437 WP_014581037.1.91783 WP_014581037.1.91852 WP_014581037.1.91877 WP_014581037.1.92316 WP_014581037.1.92382 WP_014581037.1.94239 WP_014581037.1.94571 WP_014581037.1.97563 WP_014581037.1.98130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]