SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385857526|ref|YP_005904038.1| from Neisseria meningitidis NZ-05/33

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385857526|ref|YP_005904038.1|
Domain Number 1 Region: 7-401
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.79e-96
Family AAT-like 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385857526|ref|YP_005904038.1|
Sequence length 404
Comment class I and II aminotransferase [Neisseria meningitidis NZ-05/33]
Sequence
MDKFPKSAKLDHVCYDIRGPVHKKALQLEEEGNKILKLNIGNPAPFGFEAPDEILVDVIR
NLPTSQGYCDSKGLYSARKAIVHYYQTKGLRDITVNDVYIGNGVSELITMSMQALLNDGD
EILIPAPDYPLWTAAATLAGGTVRHYLCDEENGWFPNLADMEAKITPKTKAIVVINPNNP
TGAVYSREILLEIAELARKHGLIIFADEIYDKILYDGAVHHHIAALAPDLLTVTFNGLSK
AYRVAGFRQGWMVLNGPKHHAKGYIEGLDMLSSMRLCANTPMQHAIQTALGGYQSINEFI
LPGGRLLEQRNRAWELVNQIPGVSCVKPMGAMYMFPKIDTEMYRIHDDMKFVYDLLVREK
VLLVQGTGFNWIKPDHFRIVTLPYVHQIEEAMGRLARFLQTYRQ
Download sequence
Identical sequences A0A0E0TSJ5 A0A0G4BVN6 A0A0Y6MXS8
WP_002223596.1.100005 WP_002223596.1.100113 WP_002223596.1.10070 WP_002223596.1.102147 WP_002223596.1.11246 WP_002223596.1.11354 WP_002223596.1.11579 WP_002223596.1.11628 WP_002223596.1.1184 WP_002223596.1.12105 WP_002223596.1.12521 WP_002223596.1.12740 WP_002223596.1.12868 WP_002223596.1.13577 WP_002223596.1.13938 WP_002223596.1.14530 WP_002223596.1.14800 WP_002223596.1.14890 WP_002223596.1.15470 WP_002223596.1.16566 WP_002223596.1.17793 WP_002223596.1.17811 WP_002223596.1.18584 WP_002223596.1.19474 WP_002223596.1.19810 WP_002223596.1.20103 WP_002223596.1.2102 WP_002223596.1.21463 WP_002223596.1.22322 WP_002223596.1.22987 WP_002223596.1.22995 WP_002223596.1.23356 WP_002223596.1.24135 WP_002223596.1.25496 WP_002223596.1.25829 WP_002223596.1.25993 WP_002223596.1.26128 WP_002223596.1.26810 WP_002223596.1.27066 WP_002223596.1.27579 WP_002223596.1.27855 WP_002223596.1.27878 WP_002223596.1.28559 WP_002223596.1.29030 WP_002223596.1.29437 WP_002223596.1.29467 WP_002223596.1.29968 WP_002223596.1.3148 WP_002223596.1.31993 WP_002223596.1.32542 WP_002223596.1.3272 WP_002223596.1.34570 WP_002223596.1.38045 WP_002223596.1.38201 WP_002223596.1.38726 WP_002223596.1.40262 WP_002223596.1.40352 WP_002223596.1.42319 WP_002223596.1.42555 WP_002223596.1.42983 WP_002223596.1.43602 WP_002223596.1.457 WP_002223596.1.46715 WP_002223596.1.46830 WP_002223596.1.47544 WP_002223596.1.47594 WP_002223596.1.4928 WP_002223596.1.49556 WP_002223596.1.49679 WP_002223596.1.49698 WP_002223596.1.50702 WP_002223596.1.51001 WP_002223596.1.52250 WP_002223596.1.52552 WP_002223596.1.52694 WP_002223596.1.53078 WP_002223596.1.53311 WP_002223596.1.54707 WP_002223596.1.55133 WP_002223596.1.55187 WP_002223596.1.55433 WP_002223596.1.56375 WP_002223596.1.56859 WP_002223596.1.57363 WP_002223596.1.57485 WP_002223596.1.57856 WP_002223596.1.59153 WP_002223596.1.62008 WP_002223596.1.62224 WP_002223596.1.6228 WP_002223596.1.63054 WP_002223596.1.64317 WP_002223596.1.64381 WP_002223596.1.66572 WP_002223596.1.66722 WP_002223596.1.66788 WP_002223596.1.67445 WP_002223596.1.67646 WP_002223596.1.67817 WP_002223596.1.69228 WP_002223596.1.71816 WP_002223596.1.73237 WP_002223596.1.73703 WP_002223596.1.74054 WP_002223596.1.74064 WP_002223596.1.74133 WP_002223596.1.75171 WP_002223596.1.7571 WP_002223596.1.75815 WP_002223596.1.76694 WP_002223596.1.76702 WP_002223596.1.7671 WP_002223596.1.76960 WP_002223596.1.77619 WP_002223596.1.78846 WP_002223596.1.79147 WP_002223596.1.79345 WP_002223596.1.79388 WP_002223596.1.80233 WP_002223596.1.80391 WP_002223596.1.80447 WP_002223596.1.80791 WP_002223596.1.80823 WP_002223596.1.8150 WP_002223596.1.81706 WP_002223596.1.83351 WP_002223596.1.83835 WP_002223596.1.83971 WP_002223596.1.83990 WP_002223596.1.84701 WP_002223596.1.84759 WP_002223596.1.84840 WP_002223596.1.85208 WP_002223596.1.853 WP_002223596.1.86971 WP_002223596.1.87414 WP_002223596.1.87570 WP_002223596.1.87711 WP_002223596.1.88007 WP_002223596.1.89158 WP_002223596.1.8944 WP_002223596.1.90159 WP_002223596.1.91100 WP_002223596.1.91437 WP_002223596.1.91852 WP_002223596.1.91877 WP_002223596.1.92316 WP_002223596.1.92382 WP_002223596.1.94152 WP_002223596.1.94239 WP_002223596.1.97563 WP_002223596.1.98130 gi|385857526|ref|YP_005904038.1| gi|385341627|ref|YP_005895498.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]