SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385857625|ref|YP_005904137.1| from Neisseria meningitidis NZ-05/33

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385857625|ref|YP_005904137.1|
Domain Number 1 Region: 24-356
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.59e-66
Family AAT-like 0.0000844
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385857625|ref|YP_005904137.1|
Sequence length 365
Comment histidinol-phosphate aminotransferase [Neisseria meningitidis NZ-05/33]
Sequence
MKSVRSFIRDDIQAMSAYQIADVPPGFAKLDSMESPVHPFAGHETLLQEWQARLAAAPIH
LYPNPSGSGLQEALRSAFDIPDCADIALGNGSDELIQFITMLTAKPGAAMLAAEPSFVMY
RHNAALYGMDYVGVPLNGDFTLNLPAVLEAVRKHRPALTFIAYPNNPTGVCFTRAEIEAV
IEASDGIVVVDEAYGAFNGDSFLPQAGSIPNLIVMRTVSKIGFAGLRIGYAAGCPEVIGE
LQKILPPYNMNQLSLTTAKLALQHYGIISANIDSLKNERERMFAELGKICRLNTFPSQAN
FITIRVPDADLLFDTLKQNRILVKKLHGAHPLLEHCLRITVGSPAQNDAVLNIIRQLYCQ
PTDFL
Download sequence
Identical sequences A0A0E0TRM4 A0A0G4BVQ1 A0A112BJE5 A1KV06 A9M185 E0N7L7 E3D1D7 Q9JTH8 R0VU66
WP_002212810.1.100005 WP_002212810.1.100113 WP_002212810.1.100130 WP_002212810.1.10028 WP_002212810.1.10070 WP_002212810.1.101031 WP_002212810.1.101472 WP_002212810.1.101655 WP_002212810.1.101880 WP_002212810.1.101951 WP_002212810.1.102060 WP_002212810.1.102138 WP_002212810.1.102147 WP_002212810.1.10289 WP_002212810.1.103 WP_002212810.1.10413 WP_002212810.1.10552 WP_002212810.1.10661 WP_002212810.1.10682 WP_002212810.1.10931 WP_002212810.1.11132 WP_002212810.1.11246 WP_002212810.1.11276 WP_002212810.1.11354 WP_002212810.1.11384 WP_002212810.1.11579 WP_002212810.1.11628 WP_002212810.1.11670 WP_002212810.1.11805 WP_002212810.1.1184 WP_002212810.1.11853 WP_002212810.1.12105 WP_002212810.1.12163 WP_002212810.1.12521 WP_002212810.1.12740 WP_002212810.1.12868 WP_002212810.1.13098 WP_002212810.1.13445 WP_002212810.1.13470 WP_002212810.1.13577 WP_002212810.1.13587 WP_002212810.1.13760 WP_002212810.1.13907 WP_002212810.1.13938 WP_002212810.1.14004 WP_002212810.1.14047 WP_002212810.1.14401 WP_002212810.1.14530 WP_002212810.1.14537 WP_002212810.1.14724 WP_002212810.1.14800 WP_002212810.1.14890 WP_002212810.1.15053 WP_002212810.1.15475 WP_002212810.1.15570 WP_002212810.1.1598 WP_002212810.1.16257 WP_002212810.1.16393 WP_002212810.1.16566 WP_002212810.1.17027 WP_002212810.1.17523 WP_002212810.1.17756 WP_002212810.1.17793 WP_002212810.1.17811 WP_002212810.1.18517 WP_002212810.1.18584 WP_002212810.1.18603 WP_002212810.1.18696 WP_002212810.1.18905 WP_002212810.1.19059 WP_002212810.1.19474 WP_002212810.1.19488 WP_002212810.1.19810 WP_002212810.1.19822 WP_002212810.1.19909 WP_002212810.1.20103 WP_002212810.1.20566 WP_002212810.1.2102 WP_002212810.1.21050 WP_002212810.1.21274 WP_002212810.1.21463 WP_002212810.1.22254 WP_002212810.1.22274 WP_002212810.1.22322 WP_002212810.1.2288 WP_002212810.1.22987 WP_002212810.1.22995 WP_002212810.1.23356 WP_002212810.1.23507 WP_002212810.1.24135 WP_002212810.1.24298 WP_002212810.1.24407 WP_002212810.1.24605 WP_002212810.1.24622 WP_002212810.1.25003 WP_002212810.1.25146 WP_002212810.1.25496 WP_002212810.1.2560 WP_002212810.1.25822 WP_002212810.1.25829 WP_002212810.1.25838 WP_002212810.1.2595 WP_002212810.1.25993 WP_002212810.1.26128 WP_002212810.1.26137 WP_002212810.1.26152 WP_002212810.1.26210 WP_002212810.1.26268 WP_002212810.1.26452 WP_002212810.1.26495 WP_002212810.1.27066 WP_002212810.1.27167 WP_002212810.1.27436 WP_002212810.1.27485 WP_002212810.1.27490 WP_002212810.1.27519 WP_002212810.1.27579 WP_002212810.1.27855 WP_002212810.1.27878 WP_002212810.1.28090 WP_002212810.1.28559 WP_002212810.1.28626 WP_002212810.1.28641 WP_002212810.1.2875 WP_002212810.1.29030 WP_002212810.1.29182 WP_002212810.1.29189 WP_002212810.1.29411 WP_002212810.1.29437 WP_002212810.1.29467 WP_002212810.1.29595 WP_002212810.1.29968 WP_002212810.1.30166 WP_002212810.1.30417 WP_002212810.1.30701 WP_002212810.1.30850 WP_002212810.1.30955 WP_002212810.1.3102 WP_002212810.1.3148 WP_002212810.1.3158 WP_002212810.1.31811 WP_002212810.1.31850 WP_002212810.1.31993 WP_002212810.1.32267 WP_002212810.1.32417 WP_002212810.1.32542 WP_002212810.1.32549 WP_002212810.1.32665 WP_002212810.1.3272 WP_002212810.1.32975 WP_002212810.1.33396 WP_002212810.1.33744 WP_002212810.1.34038 WP_002212810.1.34271 WP_002212810.1.34290 WP_002212810.1.34570 WP_002212810.1.34765 WP_002212810.1.34862 WP_002212810.1.35055 WP_002212810.1.35315 WP_002212810.1.35797 WP_002212810.1.35813 WP_002212810.1.35931 WP_002212810.1.36245 WP_002212810.1.36415 WP_002212810.1.36490 WP_002212810.1.36606 WP_002212810.1.3663 WP_002212810.1.37727 WP_002212810.1.38013 WP_002212810.1.38045 WP_002212810.1.38054 WP_002212810.1.38153 WP_002212810.1.38201 WP_002212810.1.38239 WP_002212810.1.38295 WP_002212810.1.38726 WP_002212810.1.38801 WP_002212810.1.38837 WP_002212810.1.39248 WP_002212810.1.40262 WP_002212810.1.40364 WP_002212810.1.40421 WP_002212810.1.40732 WP_002212810.1.40847 WP_002212810.1.40940 WP_002212810.1.40989 WP_002212810.1.41013 WP_002212810.1.41015 WP_002212810.1.41145 WP_002212810.1.41215 WP_002212810.1.42093 WP_002212810.1.42319 WP_002212810.1.425 WP_002212810.1.42555 WP_002212810.1.42572 WP_002212810.1.42614 WP_002212810.1.42656 WP_002212810.1.42983 WP_002212810.1.43602 WP_002212810.1.43776 WP_002212810.1.43810 WP_002212810.1.43987 WP_002212810.1.4434 WP_002212810.1.44572 WP_002212810.1.44580 WP_002212810.1.45333 WP_002212810.1.45642 WP_002212810.1.45671 WP_002212810.1.457 WP_002212810.1.45832 WP_002212810.1.46359 WP_002212810.1.46523 WP_002212810.1.466 WP_002212810.1.46627 WP_002212810.1.46715 WP_002212810.1.46748 WP_002212810.1.46830 WP_002212810.1.4705 WP_002212810.1.47277 WP_002212810.1.47544 WP_002212810.1.47594 WP_002212810.1.4762 WP_002212810.1.47656 WP_002212810.1.47808 WP_002212810.1.4784 WP_002212810.1.47876 WP_002212810.1.48136 WP_002212810.1.48453 WP_002212810.1.4928 WP_002212810.1.49556 WP_002212810.1.49679 WP_002212810.1.49698 WP_002212810.1.49775 WP_002212810.1.50295 WP_002212810.1.504 WP_002212810.1.5069 WP_002212810.1.50702 WP_002212810.1.51001 WP_002212810.1.51446 WP_002212810.1.52250 WP_002212810.1.52487 WP_002212810.1.52552 WP_002212810.1.52694 WP_002212810.1.52785 WP_002212810.1.53014 WP_002212810.1.53078 WP_002212810.1.53311 WP_002212810.1.53501 WP_002212810.1.53544 WP_002212810.1.54018 WP_002212810.1.54176 WP_002212810.1.54194 WP_002212810.1.54250 WP_002212810.1.54436 WP_002212810.1.54456 WP_002212810.1.54577 WP_002212810.1.54666 WP_002212810.1.54707 WP_002212810.1.54816 WP_002212810.1.5498 WP_002212810.1.55031 WP_002212810.1.55133 WP_002212810.1.55176 WP_002212810.1.55187 WP_002212810.1.55356 WP_002212810.1.554 WP_002212810.1.55433 WP_002212810.1.55764 WP_002212810.1.56186 WP_002212810.1.56375 WP_002212810.1.56376 WP_002212810.1.56544 WP_002212810.1.56763 WP_002212810.1.56859 WP_002212810.1.56890 WP_002212810.1.57008 WP_002212810.1.5706 WP_002212810.1.57238 WP_002212810.1.57270 WP_002212810.1.57289 WP_002212810.1.57363 WP_002212810.1.57387 WP_002212810.1.57485 WP_002212810.1.57626 WP_002212810.1.58178 WP_002212810.1.58469 WP_002212810.1.58501 WP_002212810.1.58882 WP_002212810.1.59122 WP_002212810.1.59153 WP_002212810.1.59180 WP_002212810.1.59188 WP_002212810.1.593 WP_002212810.1.59760 WP_002212810.1.59875 WP_002212810.1.59917 WP_002212810.1.60113 WP_002212810.1.60604 WP_002212810.1.6080 WP_002212810.1.6113 WP_002212810.1.6127 WP_002212810.1.6141 WP_002212810.1.61648 WP_002212810.1.62008 WP_002212810.1.62224 WP_002212810.1.6228 WP_002212810.1.62295 WP_002212810.1.62376 WP_002212810.1.62662 WP_002212810.1.62726 WP_002212810.1.62826 WP_002212810.1.62942 WP_002212810.1.63520 WP_002212810.1.63755 WP_002212810.1.63953 WP_002212810.1.64152 WP_002212810.1.64317 WP_002212810.1.64381 WP_002212810.1.64439 WP_002212810.1.64487 WP_002212810.1.64741 WP_002212810.1.65694 WP_002212810.1.65724 WP_002212810.1.65919 WP_002212810.1.65942 WP_002212810.1.65953 WP_002212810.1.66034 WP_002212810.1.66373 WP_002212810.1.66444 WP_002212810.1.66572 WP_002212810.1.66722 WP_002212810.1.66772 WP_002212810.1.66788 WP_002212810.1.67167 WP_002212810.1.67186 WP_002212810.1.67190 WP_002212810.1.67289 WP_002212810.1.6741 WP_002212810.1.67445 WP_002212810.1.6749 WP_002212810.1.67646 WP_002212810.1.67687 WP_002212810.1.6772 WP_002212810.1.67817 WP_002212810.1.67985 WP_002212810.1.68040 WP_002212810.1.6842 WP_002212810.1.68437 WP_002212810.1.68789 WP_002212810.1.69228 WP_002212810.1.69881 WP_002212810.1.69994 WP_002212810.1.70172 WP_002212810.1.70252 WP_002212810.1.70953 WP_002212810.1.7117 WP_002212810.1.71485 WP_002212810.1.71789 WP_002212810.1.71816 WP_002212810.1.72080 WP_002212810.1.72130 WP_002212810.1.72311 WP_002212810.1.72637 WP_002212810.1.72868 WP_002212810.1.73111 WP_002212810.1.73189 WP_002212810.1.73237 WP_002212810.1.73703 WP_002212810.1.73775 WP_002212810.1.73922 WP_002212810.1.7399 WP_002212810.1.74054 WP_002212810.1.74064 WP_002212810.1.74133 WP_002212810.1.74433 WP_002212810.1.74461 WP_002212810.1.74771 WP_002212810.1.75 WP_002212810.1.75106 WP_002212810.1.75171 WP_002212810.1.75299 WP_002212810.1.75448 WP_002212810.1.75688 WP_002212810.1.7571 WP_002212810.1.75815 WP_002212810.1.75822 WP_002212810.1.75849 WP_002212810.1.76219 WP_002212810.1.76330 WP_002212810.1.76694 WP_002212810.1.76702 WP_002212810.1.7671 WP_002212810.1.7676 WP_002212810.1.76807 WP_002212810.1.76823 WP_002212810.1.76960 WP_002212810.1.77030 WP_002212810.1.77248 WP_002212810.1.773 WP_002212810.1.77619 WP_002212810.1.77679 WP_002212810.1.77907 WP_002212810.1.78846 WP_002212810.1.78905 WP_002212810.1.79147 WP_002212810.1.79345 WP_002212810.1.79388 WP_002212810.1.7942 WP_002212810.1.79489 WP_002212810.1.796 WP_002212810.1.79729 WP_002212810.1.79912 WP_002212810.1.80076 WP_002212810.1.80233 WP_002212810.1.80391 WP_002212810.1.80791 WP_002212810.1.80823 WP_002212810.1.80981 WP_002212810.1.81005 WP_002212810.1.8150 WP_002212810.1.81608 WP_002212810.1.81706 WP_002212810.1.81791 WP_002212810.1.81964 WP_002212810.1.82998 WP_002212810.1.8305 WP_002212810.1.83351 WP_002212810.1.83633 WP_002212810.1.83707 WP_002212810.1.83835 WP_002212810.1.83867 WP_002212810.1.83954 WP_002212810.1.83971 WP_002212810.1.83990 WP_002212810.1.84565 WP_002212810.1.84604 WP_002212810.1.84701 WP_002212810.1.84759 WP_002212810.1.84834 WP_002212810.1.84840 WP_002212810.1.8494 WP_002212810.1.84962 WP_002212810.1.85200 WP_002212810.1.85208 WP_002212810.1.8529 WP_002212810.1.853 WP_002212810.1.8554 WP_002212810.1.85974 WP_002212810.1.86045 WP_002212810.1.86132 WP_002212810.1.86394 WP_002212810.1.86488 WP_002212810.1.86889 WP_002212810.1.86905 WP_002212810.1.86971 WP_002212810.1.87082 WP_002212810.1.87230 WP_002212810.1.87255 WP_002212810.1.87414 WP_002212810.1.87513 WP_002212810.1.87570 WP_002212810.1.87711 WP_002212810.1.87954 WP_002212810.1.88007 WP_002212810.1.88223 WP_002212810.1.88347 WP_002212810.1.88349 WP_002212810.1.8844 WP_002212810.1.88522 WP_002212810.1.88546 WP_002212810.1.88755 WP_002212810.1.89158 WP_002212810.1.8944 WP_002212810.1.89456 WP_002212810.1.89576 WP_002212810.1.90067 WP_002212810.1.90103 WP_002212810.1.90159 WP_002212810.1.90294 WP_002212810.1.90460 WP_002212810.1.90492 WP_002212810.1.90812 WP_002212810.1.91100 WP_002212810.1.91345 WP_002212810.1.91437 WP_002212810.1.91720 WP_002212810.1.91783 WP_002212810.1.91834 WP_002212810.1.91852 WP_002212810.1.91877 WP_002212810.1.91980 WP_002212810.1.92316 WP_002212810.1.92382 WP_002212810.1.92753 WP_002212810.1.92756 WP_002212810.1.92972 WP_002212810.1.93142 WP_002212810.1.93332 WP_002212810.1.93756 WP_002212810.1.93999 WP_002212810.1.94047 WP_002212810.1.94152 WP_002212810.1.94239 WP_002212810.1.94259 WP_002212810.1.9441 WP_002212810.1.94970 WP_002212810.1.9571 WP_002212810.1.95768 WP_002212810.1.95799 WP_002212810.1.95934 WP_002212810.1.96240 WP_002212810.1.96262 WP_002212810.1.97018 WP_002212810.1.97563 WP_002212810.1.97795 WP_002212810.1.98130 WP_002212810.1.98186 WP_002212810.1.98836 WP_002212810.1.98884 WP_002212810.1.98951 WP_002212810.1.9906 WP_002212810.1.99100 WP_002212810.1.99537 WP_002212810.1.99570 WP_002212810.1.99597 WP_002212810.1.99616 122587.NMA1771 272831.NMC1502 374833.NMCC_1486 gi|385855617|ref|YP_005902130.1| gi|218768550|ref|YP_002343062.1| gi|385340448|ref|YP_005894320.1| gi|385341536|ref|YP_005895407.1| gi|121635239|ref|YP_975484.1| gi|161870437|ref|YP_001599609.1| gi|385328864|ref|YP_005883167.1| gi|385857625|ref|YP_005904137.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]