SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385857828|ref|YP_005904340.1| from Neisseria meningitidis NZ-05/33

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385857828|ref|YP_005904340.1|
Domain Number 1 Region: 24-380
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.75e-91
Family GABA-aminotransferase-like 0.00000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385857828|ref|YP_005904340.1|
Sequence length 380
Comment 8-amino-7-oxononanoate synthase [Neisseria meningitidis NZ-05/33]
Sequence
MKVFKQQLEQLGAQNQYRSIPDLIHQGRYITRENRKMLNMSSNDYLGLASDENLRRSFLQ
QYGGNFPSFTSSSSRLLTGNFPIYTDLEELVAQRFQRESALLFNSGYHANLGILPALTTT
KSLILADKFVHASMIDGIRLSRCAFFRYRHNDYEHLKNLLEKNVGKFDRTFIVTESVFSM
DGDVADLKQLVQLKKQFPNTYLYVDEAHAIGVYGQNGLGIAERDNLIAEIDLLVGTFGKA
LASVGAYAVCNQVLKECLINQMRPLIFSTALPPFNVAWTYFIFERLPQFSKERSHLEQLS
AFLRREVAHRTQIMPSQTCIVPYILGGNEAALAKAEYLQRQGYYCLPIRPPTVPKNTSRI
RLSLTADMTTDEVRQFAACL
Download sequence
Identical sequences A0A0E0TS71 A0A0Y5KXH7
WP_014581205.1.100005 WP_014581205.1.100113 WP_014581205.1.10070 WP_014581205.1.102147 WP_014581205.1.11246 WP_014581205.1.11354 WP_014581205.1.11579 WP_014581205.1.11628 WP_014581205.1.1184 WP_014581205.1.12105 WP_014581205.1.12521 WP_014581205.1.12740 WP_014581205.1.12868 WP_014581205.1.13577 WP_014581205.1.13938 WP_014581205.1.14530 WP_014581205.1.14800 WP_014581205.1.14890 WP_014581205.1.15470 WP_014581205.1.16566 WP_014581205.1.17811 WP_014581205.1.18584 WP_014581205.1.19474 WP_014581205.1.19810 WP_014581205.1.20103 WP_014581205.1.2102 WP_014581205.1.21463 WP_014581205.1.22322 WP_014581205.1.22987 WP_014581205.1.22995 WP_014581205.1.23356 WP_014581205.1.24135 WP_014581205.1.25496 WP_014581205.1.25829 WP_014581205.1.25993 WP_014581205.1.26128 WP_014581205.1.26810 WP_014581205.1.27066 WP_014581205.1.27579 WP_014581205.1.27855 WP_014581205.1.27878 WP_014581205.1.28559 WP_014581205.1.29030 WP_014581205.1.29437 WP_014581205.1.29467 WP_014581205.1.32542 WP_014581205.1.3272 WP_014581205.1.34570 WP_014581205.1.38045 WP_014581205.1.38201 WP_014581205.1.38726 WP_014581205.1.40262 WP_014581205.1.40352 WP_014581205.1.42319 WP_014581205.1.42555 WP_014581205.1.42983 WP_014581205.1.43602 WP_014581205.1.457 WP_014581205.1.46715 WP_014581205.1.46830 WP_014581205.1.47544 WP_014581205.1.47594 WP_014581205.1.47656 WP_014581205.1.47876 WP_014581205.1.4928 WP_014581205.1.49556 WP_014581205.1.49679 WP_014581205.1.49698 WP_014581205.1.50702 WP_014581205.1.52250 WP_014581205.1.52487 WP_014581205.1.52552 WP_014581205.1.52694 WP_014581205.1.53078 WP_014581205.1.53311 WP_014581205.1.54707 WP_014581205.1.55133 WP_014581205.1.55187 WP_014581205.1.55433 WP_014581205.1.56375 WP_014581205.1.57363 WP_014581205.1.57485 WP_014581205.1.57856 WP_014581205.1.59153 WP_014581205.1.62008 WP_014581205.1.62224 WP_014581205.1.6228 WP_014581205.1.62376 WP_014581205.1.63054 WP_014581205.1.64317 WP_014581205.1.64381 WP_014581205.1.66572 WP_014581205.1.66722 WP_014581205.1.66788 WP_014581205.1.67445 WP_014581205.1.67646 WP_014581205.1.67817 WP_014581205.1.69228 WP_014581205.1.71816 WP_014581205.1.73237 WP_014581205.1.73703 WP_014581205.1.74054 WP_014581205.1.74064 WP_014581205.1.74133 WP_014581205.1.7571 WP_014581205.1.75815 WP_014581205.1.76694 WP_014581205.1.7671 WP_014581205.1.76823 WP_014581205.1.76960 WP_014581205.1.77619 WP_014581205.1.78846 WP_014581205.1.79147 WP_014581205.1.79345 WP_014581205.1.79388 WP_014581205.1.80233 WP_014581205.1.80391 WP_014581205.1.80447 WP_014581205.1.80791 WP_014581205.1.80823 WP_014581205.1.8150 WP_014581205.1.83351 WP_014581205.1.83835 WP_014581205.1.83971 WP_014581205.1.84701 WP_014581205.1.84759 WP_014581205.1.84840 WP_014581205.1.85208 WP_014581205.1.853 WP_014581205.1.86971 WP_014581205.1.87414 WP_014581205.1.87570 WP_014581205.1.87711 WP_014581205.1.88007 WP_014581205.1.89158 WP_014581205.1.8944 WP_014581205.1.90159 WP_014581205.1.91100 WP_014581205.1.91852 WP_014581205.1.91877 WP_014581205.1.92316 WP_014581205.1.92382 WP_014581205.1.94152 WP_014581205.1.94239 gi|385857828|ref|YP_005904340.1| gi|385342515|ref|YP_005896386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]