SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000005223 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000005223
Domain Number 1 Region: 171-431
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 3.92e-112
Family Transcriptional factor tubby, C-terminal domain 0.00000000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000005223   Gene: ENSDNOG00000006730   Transcript: ENSDNOT00000006735
Sequence length 431
Comment pep:novel genescaffold:dasNov2:GeneScaffold_21:85725:161995:1 gene:ENSDNOG00000006730 transcript:ENSDNOT00000006735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASRCRLGPGGDXXXXXXXXXXXXXXXXXXRALLEKKQRKKRLEPLMVQPNPEARLRRS
KPRGSEEHAPLVEPQTPHNDVVLHDQAHVLSAVASATEEDTESPSDTASKPDLQEILQRH
GISGSLNFDEETDGRSQSPYSEIERPNSASSQKSTDTGASSTAAPQAENQLGEVENLEDF
AYSPAPRGITVKCRITRDKKGMDRGLFPTYYMHLEKDENRKIFLLAGRKRKKSKTSNYLI
STDPIDLSRDGESYIGKLRSNLMGTKFTVYDHGVSPNKAQGLVEKAHTRQELAAVCYETN
VLGFKGPRKMSVIIPGMNMNHERIPFRPRYDHESLISKWQNKTMENLIELHNKAPVWNDD
TQSYVLNFHGRVTQASVKNFQIVHDNDPDYIVMQFGRVADDVFTLDYNYPLCALQAFAIG
LSSFDSKLACE
Download sequence
Identical sequences 9361.ENSDNOP00000005223 ENSDNOP00000005223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]