SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000005463 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000005463
Domain Number 1 Region: 864-1006
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.31e-56
Family FAT domain of focal adhesion kinase 0.000008
Further Details:      
 
Domain Number 2 Region: 37-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.68e-34
Family First domain of FERM 0.00033
Further Details:      
 
Domain Number 3 Region: 138-256
Classification Level Classification E-value
Superfamily Second domain of FERM 1.24e-24
Family Second domain of FERM 0.00012
Further Details:      
 
Domain Number 4 Region: 261-366
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000885
Family Third domain of FERM 0.00091
Further Details:      
 
Domain Number 5 Region: 613-696
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000256
Family Protein kinases, catalytic subunit 0.0000995
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000005463   Gene: ENSDNOG00000007032   Transcript: ENSDNOT00000007050
Sequence length 1009
Comment pep:novel genescaffold:dasNov2:GeneScaffold_2404:29958:140145:1 gene:ENSDNOG00000007032 transcript:ENSDNOT00000007050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVSEPLSRVKVGTLRRPEGPPEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEVQEIITSIVLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPEMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQXXXXXXXXXXXXXXXXXXXXXXX
XXXXRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSHDAKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLSIKTSSLAEAENMADLIDGYCRLQGEHRG
SLIVHPKKDGEKRNSLPQIPLLNLEDRRSHLSESCSLESDIYAEIPDDTLRRPGXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDIYQMEKDIALEQERNARYRPPKILEPTAYQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAERIKMRQILDRQQKQMVEDYQWLKQEEKSLDPMVYMNDKSP
LTPEKEAGYTEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLHVMELVRAVLDLKNELSQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPPSSRPEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVVANLAHPAAE
Download sequence
Identical sequences 9361.ENSDNOP00000005463 ENSDNOP00000005463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]