SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000009091 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000009091
Domain Number 1 Region: 196-489
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 4.58e-98
Family Cryptochrome/photolyase FAD-binding domain 0.0000151
Further Details:      
 
Domain Number 2 Region: 89-214
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 0.00000000000000131
Family Cryptochrome/photolyase, N-terminal domain 0.0043
Further Details:      
 
Domain Number 3 Region: 5-53
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 0.00000000000000445
Family Cryptochrome/photolyase, N-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000009091   Gene: ENSDNOG00000011730   Transcript: ENSDNOT00000011732
Sequence length 587
Comment pep:novel genescaffold:dasNov2:GeneScaffold_105:12126:231274:-1 gene:ENSDNOG00000011730 transcript:ENSDNOT00000011732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXEWNITKLSIEYDSEPFGKERDAAIKKLATEA
GVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITPEMIEKCTT
PLSDDHDEKYGVPSLEELGFDTDGLPSAVWPGGETEALTRLERHLERKAWVANFERPRMN
ANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAA
TNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHA
VACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGR
RTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLN
IERMKQIYQQLSRYRGLGLLASVPSNPNGNGGLMGYAPGENILGCSSSGSCAQGSSILHY
AHGDNQQTHLLKQGRSSMGTVLSSGKRPSQEEETQSIGPKVQRQSTN
Download sequence
Identical sequences ENSDNOP00000009091 9361.ENSDNOP00000009091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]