SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000011485 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000011485
Domain Number 1 Region: 198-284
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.37e-28
Family Carbonic anhydrase 0.0000305
Further Details:      
 
Domain Number 2 Region: 18-92
Classification Level Classification E-value
Superfamily Carbonic anhydrase 0.000000000000119
Family Carbonic anhydrase 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000011485   Gene: ENSDNOG00000014820   Transcript: ENSDNOT00000014821
Sequence length 312
Comment pep:novel genescaffold:dasNov2:GeneScaffold_5425:6536:13898:1 gene:ENSDNOG00000014820 transcript:ENSDNOT00000014821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLLVLLVLGAARPLACAESHWCYEIQAQAANTSCMGPDSWGGECKNLEQQSPINIVTS
KAQLDHKLGRFSFLGYDRKNEKVVENNGHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXWNTTTSISLSELLPEEGRLSHYFRYLGSLTTPGCEEKVVWTVFKE
PIRLHTDQILAFSRQLYYDQDQKLSMTDNVRPLQPRGQRPVFRSQAAGPLLPLPLPTLLA
PTLTCLVAGFLR
Download sequence
Identical sequences 9361.ENSDNOP00000011485 ENSDNOP00000011485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]