SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000013264 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000013264
Domain Number 1 Region: 420-708
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-82
Family Protein kinases, catalytic subunit 0.000000000136
Further Details:      
 
Domain Number 2 Region: 42-141
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-38
Family First domain of FERM 0.00000271
Further Details:      
 
Domain Number 3 Region: 966-1055
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 3.01e-35
Family FAT domain of focal adhesion kinase 0.00000444
Further Details:      
 
Domain Number 4 Region: 143-208
Classification Level Classification E-value
Superfamily Second domain of FERM 5.86e-17
Family Second domain of FERM 0.0000217
Further Details:      
 
Domain Number 5 Region: 336-373
Classification Level Classification E-value
Superfamily PH domain-like 0.00000032
Family Third domain of FERM 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000013264   Gene: ENSDNOG00000017110   Transcript: ENSDNOT00000017114
Sequence length 1062
Comment pep:novel genescaffold:dasNov2:GeneScaffold_5577:4452:298114:-1 gene:ENSDNOG00000017110 transcript:ENSDNOT00000017114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EYDRYLASSKIMAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFENSSEP
ATWASIIRHGDATDVRGIIXXIVDSHKVKHVACYGFRLSHLRSEEVHWLHLDMGVSSVRE
KYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIAL
KLGCLEIRRSYWEMRGNALEKKSNYEVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDKGCS
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTVTAPSLTIAENMADLIDGYCR
LVNGATQSFIVRPQKEGERALPSIPKLANSEKQGVRTHTVSVSETDDYAEIIDEEDTYTM
PSTGDYEIQRERIELGRCIGEGQFGDVHQGVYMSPENPALAVAIKTCKNCTSDSVREKFL
QEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQ
LSTALAYLESKRFVHRDIAARNVLVSSTDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWM
APESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPP
TLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKVQQEERMRMESRRQVTVSWDSGGSD
EAPPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXDSAALDMRGIGQVLPTHLMEERLMRQQQEMEEDQRWLEKE
ERFLKPDMRLSRGSLGREAGGEGPTGSQHIYQPVGKPDPAAPPKKPPRPGAPGHPGGLAS
LSSPGDSYNEGVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXEVGLALRTLLATVDETIPILPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMT
SLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMIGQTRPH
Download sequence
Identical sequences ENSDNOP00000013264 9361.ENSDNOP00000013264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]