SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000013518 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000013518
Domain Number 1 Region: 2-224
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 6.67e-51
Family ADP-ribosylglycohydrolase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000013518   Gene: ENSDNOG00000017442   Transcript: ENSDNOT00000017442
Sequence length 227
Comment pep:novel genescaffold:dasNov2:GeneScaffold_4417:42871:60800:-1 gene:ENSDNOG00000017442 transcript:ENSDNOT00000017442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGFGAATKAMCIGMRYWKPDRLETLIEVSIECGRMTHNHPTGFLGSLCTALFVSYAVQGK
PLVQWGREMMKVVPLAEEYCKKTIRHMAEYQEHWFYFEAKWQFYLEERKITEDKESKASF
PDHYDAEERDKTYKKWSSEGRGGRRGHDAPMIAYDALLGAGDNWTELCNRAMFHGGESGA
TGTIAGCLFGLLYGLSNIPKGLYQDLEHKEKLENLGEALYRLSTEEK
Download sequence
Identical sequences ENSDNOP00000013518 9361.ENSDNOP00000013518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]