SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000013620 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000013620
Domain Number 1 Region: 198-334
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-30
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-20
Family First domain of FERM 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000013620   Gene: ENSDNOG00000017561   Transcript: ENSDNOT00000017561
Sequence length 978
Comment pep:novel genescaffold:dasNov2:GeneScaffold_4944:249137:496163:-1 gene:ENSDNOG00000017561 transcript:ENSDNOT00000017561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGRHCQVHLLDDRRLQLLVQPKLLSRELLDLVASHFNLKEKEYFGITYIDDTGQQNWL
QLDHRVLDHDLPKKPGPAILHFAVRFYIESISFLKEKTTVELFFLNAKSSVHKXXXXXXX
XXXXXXXXXXXXXXXXFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXYMKIVEALPTYGVHYYAVKDKQGIPWWLGISYKGIGQYDLQDKVKPRKLFQ
WKQLENLYFREKKFAVEVHDPRRISVSKRTFGQSGLFVQTWYANSSLIKSIWVMAISQHQ
FYLDRKQSKKITSASLDDIAMDLTETGTPRFSKLVXXXXXXXXXXXXXXXXXXXXSQDSE
VSEEQKREKILELKKKEKLLQEKLLKKVEELKKICLREAELTGKMPKEYPLTIGEKLPQV
RRRVGTAFKLDDNLLPSEEDPALQELESNFLIQQKLVEAAKKLANEPDLCKTVKKKRKQD
YTDAVKKLQEIENAINEYRIRCGKKPSQKATVILPEDIIPSESSSLSDTTTYDDPNDSFT
TTGQRPSSVPHSPRILPPKSLGIERIHFRKSSVNEQFVDTRQSREMLSTHSSPYKTLERR
PPGGRSMPTTPVLTRNAYRSSHLEPEPSSQHHRQRSGSLESQSHLLSEMDNDKPFFSLSK
SQRSSSTEILDDRSSYTSQSSTEYYCVTPTTSPYYTTQTLDTRARGRRRSKKQNVSTSNA
GSMPDLIQKDSLRNGVYCKSQVTPSSSYYSAGYPPXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYSSVSSTNA
SGNWRTQITIGLSEYESPAHPSYTSCYGNVYNPLPSPSRQYTGTSQLDSTDGRRLEDSLE
SNEQRLFWHEDSKPGTLV
Download sequence
Identical sequences ENSDNOP00000013620 9361.ENSDNOP00000013620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]