SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000013946 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000013946
Domain Number 1 Region: 207-308
Classification Level Classification E-value
Superfamily Ras GEF 4.18e-27
Family Ras GEF 0.0043
Further Details:      
 
Domain Number 2 Region: 404-490
Classification Level Classification E-value
Superfamily Ras GEF 3.66e-20
Family Ras GEF 0.0044
Further Details:      
 
Domain Number 3 Region: 42-107
Classification Level Classification E-value
Superfamily Ras GEF 0.0000000000000235
Family Ras GEF 0.004
Further Details:      
 
Domain Number 4 Region: 648-686
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000971
Family Ras-binding domain, RBD 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000013946   Gene: ENSDNOG00000017972   Transcript: ENSDNOT00000017972
Sequence length 686
Comment pep:novel genescaffold:dasNov2:GeneScaffold_3791:11132:118200:1 gene:ENSDNOG00000017972 transcript:ENSDNOT00000017972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSIQDWGEEVEEGAVYHVTLKRVQIQQAANKGARWLGVEGDQLPPGHTVSQYETCKIRTI
KAGTLEKLVENLLTAFGDNDFTYISIFLSTYRGFASTKEVLELLLDXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXGLPNTISFSLEEEEELEDGGSAEFTFFSEDLVAEQLTYMDAQLFK
KVVPHHCLGCIWSRRDKKENKHLAPTIRATISQFNTLTKCVVSTILGERELKTQQRAKII
EKWINIAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVMQGTVPYLGTFLTDLTM
LDTALQDYIEGGLINFEKRRREFEVIAQIKLLQSACNSYCMTQNKKFIRWVQKYNLSCET
EAAADTSATPQSRKSMVELSLLFLGSDIITSSTPTKEQPKSTASGSSGESMDSVSVSSCE
SNHSEAEEGSITPXXXPDEPPKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTSQDKTPAVIQ
RAMLKHNLDSDPAEEFELVQVISEDK
Download sequence
Identical sequences 9361.ENSDNOP00000013946 ENSDNOP00000013946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]