SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000014822 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000014822
Domain Number 1 Region: 23-325
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.88e-61
Family ADP-ribosylglycohydrolase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000014822   Gene: ENSDNOG00000019114   Transcript: ENSDNOT00000019114
Sequence length 329
Comment pep:novel genescaffold:dasNov2:GeneScaffold_3904:1432:4941:1 gene:ENSDNOG00000019114 transcript:ENSDNOT00000019114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IERYVAAMVLRISLSLTNFNQKWEFLRDGGKIHQQLAQFGGLDAIDVAKWRVSDDTVMHL
ATAEALLEAGEVKNLSQLYSLLAKHYQDCMEDMDGRAPGGASFQNAMQLKPDKANGWRIP
FNSHEGGCGAAMRAMCIGLRFPHHNQLDTLIKVSIESGRMTHHHPTGYLGALASALFTAY
AVNGKPPRQWGKGLMEVLPEAKKYIVQSGYFVEENLHHWSYFQNQWEKYLKLRGILDGIS
DPTFPEPFNVKERDEFYTSVSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGG
DSDSTAAIAGCWWGVMYGFEGVSPSYEKL
Download sequence
Identical sequences ENSDNOP00000014822 9361.ENSDNOP00000014822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]