SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000015322 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000015322
Domain Number 1 Region: 85-194
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-38
Family Second domain of FERM 0.000000594
Further Details:      
 
Domain Number 2 Region: 486-573
Classification Level Classification E-value
Superfamily Moesin tail domain 4.97e-33
Family Moesin tail domain 0.00000413
Further Details:      
 
Domain Number 3 Region: 2-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.88e-24
Family First domain of FERM 0.0000102
Further Details:      
 
Domain Number 4 Region: 195-229
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000369
Family Third domain of FERM 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000015322   Gene: ENSDNOG00000019760   Transcript: ENSDNOT00000019760
Sequence length 573
Comment pep:novel genescaffold:dasNov2:GeneScaffold_4050:10213:124343:1 gene:ENSDNOG00000019760 transcript:ENSDNOT00000019760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKK
VTAQDVRKESTLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVL
LASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLR
EDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXALLENEKKKREMAEKEKEKIEREKEELMEKLKQIEEQTKKAQQE
LEEQTRKALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLAXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXAQMVQEDLEKTRAELQTAMSTTHVAEPAENEQDEQD
ENGAEASADLQADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMI
HAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
Download sequence
Identical sequences ENSDNOP00000015322 9361.ENSDNOP00000015322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]