SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000015623 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000015623
Domain Number 1 Region: 332-457
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 6.54e-38
Family Transcriptional factor tubby, C-terminal domain 0.00000674
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000015623   Gene: ENSDNOG00000025748   Transcript: ENSDNOT00000023748
Sequence length 457
Comment pep:novel genescaffold:dasNov2:GeneScaffold_1861:734:11147:-1 gene:ENSDNOG00000025748 transcript:ENSDNOT00000023748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPAPGQKLRKKRTEVPEAPCPTASKPPRAGAARRGRPRGEPAPHPAEARAPQTLYSKFLR
DPEAKQRDPRDTFLVARAPDAEEEEEEDGEEEEQEKKEKLPLPLRKPRKEKAAADGRERR
AGAPGPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLLGNRFTAFDSGRSPRRSSAAGESLR
QELAAVIYETNVLGFRPLRMTVLIPGMSADNERVPIRPRNASDGLLVRWQNKSLESLVAL
HNKPPVWNEDSGSYTLNFQGRVTRASVKNFQIVHADD
Download sequence
Identical sequences 9361.ENSDNOP00000015623 ENSDNOP00000015623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]