SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000016525 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000016525
Domain Number 1 Region: 39-92,137-198
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.82e-26
Family Motor proteins 0.0025
Further Details:      
 
Domain Number 2 Region: 339-444
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.86e-26
Family Motor proteins 0.0016
Further Details:      
 
Domain Number 3 Region: 2106-2193
Classification Level Classification E-value
Superfamily PH domain-like 1.19e-17
Family Third domain of FERM 0.027
Further Details:      
 
Domain Number 4 Region: 1249-1305
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000217
Family First domain of FERM 0.035
Further Details:      
 
Domain Number 5 Region: 1598-1665
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000297
Family SH3-domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000016525
Domain Number - Region: 1907-1945
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.001
Family First domain of FERM 0.08
Further Details:      
 
Domain Number - Region: 561-597
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0292
Family Motor proteins 0.0071
Further Details:      
 
Domain Number - Region: 561-602,756-788,832-862
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0867
Family Motor proteins 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000016525   Gene: ENSDNOG00000025971   Transcript: ENSDNOT00000025669
Sequence length 2207
Comment pep:novel genescaffold:dasNov2:GeneScaffold_3367:1937:55105:1 gene:ENSDNOG00000025971 transcript:ENSDNOT00000025669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALMGDFVWIDLRSRQEFDVPIGAVVKLCDSGQIQVVDDEGNEHWISPQNAAHIKPMHPTS
VHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXRNSRDQCCIISGESGAGKTESTKLILQFLAAISGQHS
WIEQQVLEATPILEAFGYSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTFENLDACEVLFSPSLATAASLLEVNP
PDLMTCLTSRSLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVDKINAAIYKPPS
QEAKSSRRSIGLLDIFGFENFAVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNFLKLKNAATLIQRLWRGHNC
RRNYRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XAYARGMIARRLHRRLRAEYLRRLEAEKMRLAEEEKLRKEMGAKKAREEAERKHQARLAQ
LAREDAERELKEKAAARQKKELLEQMEKARQEPVNHSDMVDKMFGFLGTSGGLPGQEGQA
PRGFEDLECGRRAMVEEDLDAALPLPDEDEEDLSEYKFAKFAATYFQGTTTHTYTRRPLK
QPMLYHEDEGDQLAALAVWITILRFMGDLPEPKYHMAMTDGSEKVPVMTKIYETLGKKTY
KRELQALQGEGETQLPEGQKKSSVRHKLVHLTLKKKSKLTEEVTKRLQDGEATLQGNSML
EDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFA
PSEKFVKHLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVT
FMDGTTKTLLTDSATTAKELCHALADKISLKDKFGFSLYIALFDKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI
YAQRRADVQKVNEDVVNYARFKWPLLFSRFYEAYKVSXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXECHVSLTMGCAAPHPGRAGLTAAGTCSPCWSCRGAKLLSP
SFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGEESGFLSFA
KGDLIILDRDTGEQVMNSGWASGINERTKQRGDFPTDCVYVMPTVTRPLQETVXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAFEVESSTKARDFC
QNIAARLLLKSSEGFSLFVKIADKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLT
YQVFFMKKLTSTMPEKDPMTDSIFHYYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXGGFFKLKQTTEPHFPEILLIAINKYGVSLIDPRSKDILTTHPFTKISNWSSGNTYFH
ITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRSFRSGK
Download sequence
Identical sequences ENSDNOP00000016525 9361.ENSDNOP00000016525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]