SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000017153 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000017153
Domain Number 1 Region: 3-162
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.27e-28
Family ADP-ribosylglycohydrolase 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000017153   Gene: ENSDNOG00000025495   Transcript: ENSDNOT00000025201
Sequence length 196
Comment pep:novel scaffold:dasNov2:scaffold_27275:42566:43811:-1 gene:ENSDNOG00000025495 transcript:ENSDNOT00000025201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEFKNDPDRGYGAGVVTVFKKLLSPK
CRDVYEPARAQFNGKGSYGNGGAMRVAGIPLAFSRVQDVQKFARLSAQLTHASSLGYNGA
ILQALAVHLALQGDLSSEHFLQLLLGHMEELESDARSLTDARELGMEEHPYCSRLKKIGE
FLEQESVTREEVVSEL
Download sequence
Identical sequences ENSDNOP00000017153 9361.ENSDNOP00000017153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]