SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000017459 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000017459
Domain Number 1 Region: 296-398
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 4.71e-34
Family Cryptochrome/photolyase FAD-binding domain 0.00035
Further Details:      
 
Domain Number 2 Region: 71-205
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 5.63e-31
Family Cryptochrome/photolyase, N-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000017459   Gene: ENSDNOG00000025016   Transcript: ENSDNOT00000025117
Sequence length 588
Comment pep:novel genescaffold:dasNov2:GeneScaffold_7197:79534:115528:1 gene:ENSDNOG00000025016 transcript:ENSDNOT00000025117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATGVMAGATAPTPVSGADGASSVHWFRKGLXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYD
SEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRME
LPKKPVCSVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLSPXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKRNST
PPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWID
AIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPSKDA
Download sequence
Identical sequences ENSDNOP00000017459 9361.ENSDNOP00000017459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]