SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|230366|estExt_fgenesh1_kg.C_50011 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|230366|estExt_fgenesh1_kg.C_50011
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 2.07e-17
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00024
Further Details:      
 
Domain Number 2 Region: 51-102
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 6.02e-16
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|230366|estExt_fgenesh1_kg.C_50011
Sequence length 110
Sequence
MAYQLYRNTTLGNTLQETLDELIQFGQITPQLALKVLVHFDRTMNNSLAQKVKNRLTFKA
GKLNTYRFCDNVWTFLLSDVEFRDVSELCKGETVKIVACDGKAVPPTKDD
Download sequence
Identical sequences E9FYH2
jgi|Dappu1|230366|estExt_fgenesh1_kg.C_50011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]