SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|304824|PASA_GEN_3000012 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|304824|PASA_GEN_3000012
Domain Number 1 Region: 278-335
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 4.71e-23
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00011
Further Details:      
 
Domain Number 2 Region: 6-48
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000000107
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00048
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|304824|PASA_GEN_3000012
Domain Number - Region: 226-279
Classification Level Classification E-value
Superfamily ARM repeat 0.000633
Family Armadillo repeat 0.079
Further Details:      
 
Domain Number - Region: 77-166
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.0654
Family ETX/MTX2 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|304824|PASA_GEN_3000012
Sequence length 335
Sequence
MAANQALVSKLYRGVIEDVINGVREAFLDEGIDEAVLLELKQNWENKLQSSKAIDPVTDP
AETSLQSKLQQRSSLPSKAGQQASSTAPANNSTPQQAASTAKQPAAAAQTPATTPNAATG
AATTAAAAAPATTTVRMVPVQITVPPQAGVTGHTAAKSITVHVPAHALQGGAAGAQLQTI
LSSPAVTAALSLPVEMATTVLQQHINNALQSTAARSQSRTDNGGVTQLDGPGDSSDDDDD
VEDDDDDDVEEEDDHDDEEIDADNEENADEEPLNSEDDVTDDDPSVLFETDNVVVCQYDK
ITRSRNRWKFHLKDGIMNINGRDYVFQKANGDAEW
Download sequence
Identical sequences E9GM63
jgi|Dappu1|304824|PASA_GEN_3000012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]