SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|314156|NCBI_GNO_1000394 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|314156|NCBI_GNO_1000394
Domain Number 1 Region: 426-658
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.87e-27
Family RecA protein-like (ATPase-domain) 0.032
Further Details:      
 
Domain Number 2 Region: 273-365
Classification Level Classification E-value
Superfamily DNA primase core 0.0000144
Family Primase fragment of primase-helicase protein 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|314156|NCBI_GNO_1000394
Sequence length 688
Sequence
MNAVCKAHVQTLSYSRKLVATRMKREPTRLIVPSPGLIRQIHILTDGDIRDISSNEIRRI
TKSSFAGFQEGYTCVAVNCPSCNQASSPTTIKDANNDLGKLYINLRTGYSFCTRCFLSGP
WSSLSKYIQALDVFQLKSEKVKSSPPSIAQHLSQYTGTTSTTETNEMKGLWNLAQPIHSL
SEETLGPFLDKLSLGVGRRTQTSADLSVETLKKVGAKVNLDLEQLILPCLTSKDAEFRSV
KILTPNHNASEAVESDASKEIEDYHPIIEKNLPKQHPWLLGYHLAKGRDEVILTATAADT
LTALDCLAVPAVCLPSGISNLPLATMAFLESFRKITLWLGHGVQGSDCARAFARKLGEKR
CHLIRSSEETPSALLCRMKGKNVAQVLKAALPMTHKSVTTFSSLRKEVYEEITQSSKVSG
VRWRRFPILTDLLKGHRRGELTVFTGPTGAGKTTFLSEYSLDLCGQDVRTLWGSFEIRNV
RLAKMMLQQFSGLLLESETRETFDIVADKFEKLPMYYLAFHGQQNVTSVLEAMSHAVYVY
DISHVVIDNLQFMMGTSNENLSMDRYHRQDQIIGSFRRFATDNNVHVTLVIHPRKEAMEE
LSTSSIFGGAKASQEADNILILQDKRTNDPNHRRKYLEVSKNRYAGDLGVMPLEFHKESL
SFAPRKKNANREREKRPTSFKCYVYILS
Download sequence
Identical sequences E9G4U0
jgi|Dappu1|314156|NCBI_GNO_1000394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]