SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|44795|e_gw1.8.287.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|44795|e_gw1.8.287.1
Domain Number 1 Region: 169-427
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.81e-52
Family Voltage-gated potassium channels 0.00071
Further Details:      
 
Domain Number 2 Region: 5-104
Classification Level Classification E-value
Superfamily POZ domain 5.23e-33
Family Tetramerization domain of potassium channels 0.00000297
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|44795|e_gw1.8.287.1
Domain Number - Region: 117-153
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0262
Family KorB DNA-binding domain-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|44795|e_gw1.8.287.1
Sequence length 508
Sequence
MDGENRIVLNVGGIRFETYKTTLKKIPATRLSRLTEALVNYDPILNEYFFDRHPGVFSQI
LNYYRTGKLHYPSHVCGPLFEEELEFWGLDSNQVEPCCWMTYTVHRDTQQTLAILDKLDI
ETEKPTEEEIARKFGYEEDYLAGRLSLWQRFKPATWSLFDEPYSSLPAKGVAVISVFFIC
VSVLSFCLKTHPSMRVPFLRNITVNGPGNASYFLLDKVKTEPHEAFFYVELVCNIWFTLE
ISIRFVVSPDKCDFLQSPVNVIDLVATLSFYTDMLLQAMCVIIHEKKNNTFQELAHHVDN
ADILEFFSIIRILRLFKLTRHSPGLKILIHTFKASAKELTLLVFFLMLGIVIFASLVYYG
ERLQANPHNDFKSIPEGLWWAIVTMTTVGYGDMAPKTYAGMFVGALCALAGVLTISLPVP
VIVSNFSMFYSHTQARSKLPKRRRRVLPVEQPRNRKQRVPDRASNNQGQQQQSRADGIGR
RFAAGTTKLTQPFINRLGLFTIKEIILK
Download sequence
Identical sequences E9G2I2
jgi|Dappu1|44795|e_gw1.8.287.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]