SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|117073|fgenesh1_pg.C_scaffold_213000035 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|117073|fgenesh1_pg.C_scaffold_213000035
Domain Number 1 Region: 347-423
Classification Level Classification E-value
Superfamily TPR-like 0.0000885
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|117073|fgenesh1_pg.C_scaffold_213000035
Domain Number - Region: 263-315
Classification Level Classification E-value
Superfamily MIT domain-like 0.0719
Family MIT domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|117073|fgenesh1_pg.C_scaffold_213000035
Sequence length 535
Sequence
MKAGRLHLWSDCLSITKIRPRLPVDFLISWHPIATRLTIKLLSRGSTLLSFPAAKNSCRQ
LQLDGQGDILESAVLVYKRTNFIMDPTCKSFESLKEAGNQIFRETFRDDSLSPAVYQHRM
CSALQYYNKAATLTRNPQEKSSILKNMAATKFRIGERLYTRKYQHQQPAFANLDSTLQLE
KELKFYLEGSLEDFVEAVEIGKPFQNADWIYKLLGSQYDCALFLWDFFLKSLKNEKLPIL
FRQLHKFCWNLTGLGRSIFFLKLARLTFKNAIELQENGRFTESLQLLRDNYLNIEEAKKD
KYQIEEAIELQESNFLHLSIGESTLARQKGDELWRGITMDQENIQMELVWDAVDCYVQSI
VLSRDIKSLESEAMAHSHLGRLYELLRFNDKSHDHYKLTVDLVVAMQPKNFNNHPWYKQA
LAGLHQFQQQQRWKEKGEKERVRAPIVEELKGVLYEMKRASARSAESLIDFIYANHPPKN
GQQKSADGNLKTQLKMALLHYHPDKQNMETHGLEWMVMAEEITLLLTFHFSVFKT
Download sequence
Identical sequences E9HRF7
jgi|Dappu1|117073|fgenesh1_pg.C_scaffold_213000035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]