SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|245666|SNAP_00013724 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|245666|SNAP_00013724
Domain Number 1 Region: 31-222
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.39e-25
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|245666|SNAP_00013724
Sequence length 253
Sequence
MKQRRNRDNTAGCSSPSLECDIRLWGKGGLFENGQEYQYSYQTYTLTGVREPIWFGSSFG
IRGNLFIQKQGAEAILKLSDLTLGMHNGDEALFNTIKFLKKPDLITGFYVESSDVEWSVN
IKKALASKLQMDASAGDISKGETPFMRTVEDTINGACTTSYTFSDDGKGRYLLFKQRNQN
DCTNVPRVGFNTFGTTTCTGKQEDELQSTTQVYYKLSRELGKTLKVTHISSFGYQVLQWY
PPAGSPLYNRAKY
Download sequence
Identical sequences E9GNS9
jgi|Dappu1|245666|SNAP_00013724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]