SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|300087|PASA_GEN_0100385 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|300087|PASA_GEN_0100385
Domain Number 1 Region: 363-476
Classification Level Classification E-value
Superfamily TPR-like 0.000000000493
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|300087|PASA_GEN_0100385
Sequence length 586
Sequence
MDITSKHYEEGQYLKCITILSDLPTHSLFEKCVVENNVLVSKFQTSFVQGDDLLRKTVSD
DLFRLQAKLLALPHEKEYTFLTLCCTTNAIYSLLNYQCCEENSVKAVQIGNGAFEKVLCN
LQIFCYQEQHSIVDKFIGLVHQLLQCKKLKSDELSLLLYCCTLTCLIKLDLKFVELVKSI
LDILECSLKNKTPGVKSTDIFLLSPLEMSLQSSGSYCSIICDFSRLFLSMFYCTNLSWPE
ALAVKSTQNSQMSEILEIFKMYASLHLANPSSDEKIEEYLNERNSYLYFASFAGAGELAQ
TQACSIVMAYAATQFQVLDQTNFEIEALKIAEESLLKSPVFQCSIHTELPGFLLGQMKLF
SLPEVSVLRYQLARIFLKNQRYQEAAEEYEKLSSETHLQHKSEPFSSVFKLVSPSDTIVL
HERILALVLSNNYQKALDAIDSSLEEDWFTLYLHAQICAHLKQYKKAIQLINRSILQLNS
ITFAVSGTKDVIRSQFCFKLSQLFDEIGNLKDAHHQLRLSFQYGISMNCKMLEFYHKFTR
KLGAQKEIPIPSDSHQEELIATILEHSDDLTLNYLIRDSYAAFSLP
Download sequence
Identical sequences E9FQR5
jgi|Dappu1|300087|PASA_GEN_0100385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]