SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|305914|PASA_GEN_4200068 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|305914|PASA_GEN_4200068
Domain Number 1 Region: 277-369
Classification Level Classification E-value
Superfamily TPR-like 0.000000000197
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|305914|PASA_GEN_4200068
Sequence length 509
Sequence
MAEIPTTTNGTSSETASASGPVESSSKKEQVTEIAMNLLVQGRRHLLVSDIPSAIAALAE
SVQLLAEQYGEFADECAESYYYYGMALLEMARTDCDVLGDAVEGGDKTEGEGESEDEENG
DDEEESEEEEDSGEKSTNGDVETNGKTDKPDDSEVKEKTEVADEKSTTETAESKPETAKP
AASEAANVAKAPDVEMKESEPSLEHTNGQNSGSKAEEKTDTAQNGEKSVAKPKNEAKGKS
LKAAGSSSGDKVDSVADDDVDVNTDEVPNLQLAWEVFEIAKNIYQRKAETDPAAKPKLAD
ALIRLAEVAIESENYTSAIEDLQKCLEIQKASFPADSRSLAETHYQLGVAFTFTTEFKEA
VRSFESAASVIQLRIENLKNPAEKKPSMEEPKNLFHTIEGEIEELETLLPDIRDKIADTI
DLEKEAIRKLAENGINGAGTSSSADGANGSMETDVAMLSGESPNSGKPATDITHLIRKKR
KPDDNAGTEASAAKKICPDGAVVADATSV
Download sequence
Identical sequences E9GTN8
jgi|Dappu1|305914|PASA_GEN_4200068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]