SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|306376|PASA_GEN_0500031 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|306376|PASA_GEN_0500031
Domain Number 1 Region: 90-185
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-29
Family PDZ domain 0.0099
Further Details:      
 
Domain Number 2 Region: 11-65
Classification Level Classification E-value
Superfamily L27 domain 4.32e-21
Family L27 domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|306376|PASA_GEN_0500031
Sequence length 199
Sequence
MAATTISEQLSLDKDINRAVELLEKLMKSGEVPTAKLSALHKVLQSDFLRAVREVYEHVY
ETVEMGGSPDVRASATAKATIAAFAASEGHAHPRVVELPKTDEGLGFNVMGGREQNSPIY
ISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKAAHGSVKLVVRYTPKIL
EEMEMRFDKQRTTRRRQPY
Download sequence
Identical sequences E9FYC4
jgi|Dappu1|306376|PASA_GEN_0500031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]