SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|311979|NCBI_GNO_0500148 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|311979|NCBI_GNO_0500148
Domain Number 1 Region: 314-620
Classification Level Classification E-value
Superfamily TPR-like 5.92e-103
Family Tetratricopeptide repeat (TPR) 0.0000000368
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|311979|NCBI_GNO_0500148
Sequence length 622
Sequence
MAFRELVDGNCGGRNPMLKVASHFTRDQGFRQDVPVSHRHPDTRPEDVMVREFLEGIPPP
SQVGSRGAFNMDSLLREMRDLEKPQGIARPPIQPGPNVAHYAFDDKNWAEDFLRKEPHVI
PEDLPSASGWSQEFLDSPGYMGVVDDYAEWDNHWDSLTSHIEKPGFSAPGALAQTAGEII
DRMKDPKFAQSEFLQFMHKVNQGEEDLTSEPRTTTAHSNSNWAEEFSGSEGVTRQPESSA
DQDWAAEFTTNRQPDLADEWTKEFNDGASAEVFRGGNPAQDDFWSQLQQDWEKAADDNPA
SYGWLKETQQDPLSEYTFVAENPYQDNADPYNTGLQKRLEGDLPSAILLFEAALKKDPEH
VKAWEVLGLTLAENEQDPGAITAYKRCLALEPTNLVAMMGLAVSYTNESYQLQACQALED
WLRNNPKYGHLTSPSSARVNERERTFTSLVSGDTFNRVQDMYLTAARLQPSQDLDPDVQT
GLGVLLNLSGDFDKAPDCFRAALQMKPNDSLLWNRLGATLANGGKSEEAIESYYKALELS
PGFIRARYNLAVSCINLGAHREAAEHLVSALLLQARRSKRVMSDNIWSTLRMVLNLMNRR
EFIADIDAKDLTRLAAEFGIAE
Download sequence
Identical sequences E9FYH6
jgi|Dappu1|311979|NCBI_GNO_0500148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]