SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|312136|NCBI_GNO_0500306 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|312136|NCBI_GNO_0500306
Domain Number 1 Region: 322-507,548-712
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.41e-77
Family YicI catalytic domain-like 0.00087
Further Details:      
 
Domain Number 2 Region: 101-320
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.77e-28
Family YicI N-terminal domain-like 0.01
Further Details:      
 
Domain Number 3 Region: 716-795
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 4.53e-20
Family Putative glucosidase YicI, domain 3 0.012
Further Details:      
 
Domain Number 4 Region: 45-89
Classification Level Classification E-value
Superfamily Trefoil 0.0000017
Family Trefoil 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|312136|NCBI_GNO_0500306
Sequence length 932
Sequence
MKKWTKILISVILLAIVVTAIVLPIVLPVENEPNTTTEATTVAPNPTNNRIECYPFQNMA
KGNCTSAGCLWDSKNQHPNCYLPDSSVYGYEINGTVTDLPNQMGFTLDLRRRRAADDSTT
FSLYGGDFDQVTFEVNYYSDSTLGLRFYPKDANASELRPPVALTLTETPLTDNVHYETRI
VSSENGEPFNVQIIRKSSQAVIFDTSLGGLTIAEQFLMISTKLPTRYLYGFGENTHDNLL
HDMRYKMWPIFSRGQAPGMRDINVYGAQPFYMASEEDGSSHGVFLFNSHAMDVTTMPYPG
LTFRAIGGMLEFFVFLGPEPESVVKQYSDVIGKTFMPPYFALGFQLSRWGYRNTSNLKDA
VDRTRDLEIPHDVQYADIDYMDARKDFTIDPVNFGDLPALVDEVKKDGLRFGIILDPAIA
HERTGYLPFRRGDNNKVFVQWANSSYKPEGQAANDNNLYGRVWPIRETAFPDFFKTKTKQ
WWTEEIRIFREEQKLNFDILWIDMNEPSNFLTGTLLQCPTNRWDDPPYGTMAAHVGATGR
LSEKTICMASNFGENDEFLHYEVHSLYGYSHAMATQSALRQILTGKRSMVLSRSTFAGSG
KYAGHWLGDNYSTWNQMANSIIGMIEFNMFNIPYVGPDICGFNLNTEEEMCERWMELGAF
YPFSRNHNSFIFKDQDPAQWPDTVAVSGRKALNIRYRLLPYLYTLFYDSHTIGGTVVRPL
YHEYPKDISARSIDKQFMWGPALLISPVLEQGKLSVDVYIPDDVWYDYYTGERIEVLGKT
NLSAPRDHINLHLRGGYILPAQKPALNTMLSRQNNFELLVPLNDQNSASGKMFWDDGESF
NTIEDGLYQINTFELKADTLTIKVEKVSNKSWSGITQLLDTIQFMGWSKNPTSVAVNGVI
LGKDSYSYNETNQNLFLFYEFNMNDDFVVEFQ
Download sequence
Identical sequences E9FYY7
jgi|Dappu1|312136|NCBI_GNO_0500306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]