SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|315302|NCBI_GNO_1400007 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|315302|NCBI_GNO_1400007
Domain Number 1 Region: 257-403
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000215
Family Tetratricopeptide repeat (TPR) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|315302|NCBI_GNO_1400007
Sequence length 412
Sequence
MRNSPLRAIPVAFQENVLLKDAEVEEALHAFADPLLKAANVSPESVRIFLVSTPIVNAAS
TIGDIIFVNTGLILECEGADELAAVLAHEIGLLQKHHVITRLGALEGASKMGLGAVGLGA
ILTVLTGNPGPLILGASAGQHLAERSFLKFNRGQESEADQASFALLQAVGWPREGAVSFI
KKLLADRGPLQDSRTVYGQTHPLHEERIRLASLKLTPPGIIPFPLQQKFRLMQTKIRAYT
LPASQVLADLRIRQSPYRNYGEAIGLYRQGNLDEALKRLDLSKQTASPAYAEELRAQILL
EKGALKDAETAILLALQQMNKPHSTVYVLAAQIKIALGKLEEARELLDKAASKDPTDSQP
WYFLSIVYGKQNKAPQADLALAEKHLRLGEGVRAKEYAERAQKNLPPKVPLI
Download sequence
Identical sequences E9G9C6
jgi|Dappu1|315302|NCBI_GNO_1400007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]